(data stored in ACNUC7421 zone)

EMBL: CP000859.PE560

CP000859.PE560       Location/Qualifiers
FT   CDS             628425..630194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0560"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: fra:Francci3_0479 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66370"
FT                   /db_xref="GOA:A8ZU58"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU58"
FT                   /protein_id="ABW66370.1"
FT                   /translation="MGTTVAITGVNSYFASTILPLLETDPDVDKVIGIDVSPWKGGYGK
FT                   VEFHRADIRDPQIADILAGADVVYHLAFIVGQIQDTQKALDININGSRNVFESCVKNNV
FT                   SKVIYTSSSTVYGAHADNPIGFREDAPLRVNEDSYYNESKVKVETFARDFFRNHPDITF
FT                   TVIRSALLFGPHIDNMFSKLYDLPVSSLPMGRTTHNQYIHEEDLGSALHMAMACDLPGI
FT                   YNVGADDGMATRHAFAMAGVRIIPVPTSLLKLVAAVGFKLRLFSAGRGWVSLGEYTIFM
FT                   NCDKFKQATGWKPRYTSRQTFESFLAARERDAKDNPIQATLSWIFKSGPRTRPTMAVLN
FT                   VFRLGKVPGLRRAIPWMNPKKNSMSYLPVNRSLGQVVDQVLPAQVVHDFIDAADTYVIM
FT                   DKCGCRLARKCQHHTPDIGCLFMGETALKMPHGVSRRVTREQAHAHVDRAISVGLIPMT
FT                   GKVRVDNFIFLTPDRSKLLSVCFCCHCCCMMTSLKHIPGDYLDGIMPRIEGLEISVTDA
FT                   CVGCGTCVEFCGFGAITIENGKAVHNDQCRGCGRCETRCPNHAVRITINNPNVTEDVKK
FT                   RIEQYVDFKGTAA"
     MGTTVAITGV NSYFASTILP LLETDPDVDK VIGIDVSPWK GGYGKVEFHR ADIRDPQIAD        60
     ILAGADVVYH LAFIVGQIQD TQKALDININ GSRNVFESCV KNNVSKVIYT SSSTVYGAHA       120
     DNPIGFREDA PLRVNEDSYY NESKVKVETF ARDFFRNHPD ITFTVIRSAL LFGPHIDNMF       180
     SKLYDLPVSS LPMGRTTHNQ YIHEEDLGSA LHMAMACDLP GIYNVGADDG MATRHAFAMA       240
     GVRIIPVPTS LLKLVAAVGF KLRLFSAGRG WVSLGEYTIF MNCDKFKQAT GWKPRYTSRQ       300
     TFESFLAARE RDAKDNPIQA TLSWIFKSGP RTRPTMAVLN VFRLGKVPGL RRAIPWMNPK       360
     KNSMSYLPVN RSLGQVVDQV LPAQVVHDFI DAADTYVIMD KCGCRLARKC QHHTPDIGCL       420
     FMGETALKMP HGVSRRVTRE QAHAHVDRAI SVGLIPMTGK VRVDNFIFLT PDRSKLLSVC       480
     FCCHCCCMMT SLKHIPGDYL DGIMPRIEGL EISVTDACVG CGTCVEFCGF GAITIENGKA       540
     VHNDQCRGCG RCETRCPNHA VRITINNPNV TEDVKKRIEQ YVDFKGTAA                   589
//

If you have problems or comments...

PBIL Back to PBIL home page