(data stored in ACNUC7421 zone)

EMBL: CP000859.PE561

CP000859.PE561       Location/Qualifiers
FT   CDS             630197..631093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0561"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dde:Dde_0800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66371"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU59"
FT                   /protein_id="ABW66371.1"
FT                   /translation="MKESTKRIIRYHGLRPDRAFHNWLYFAHYRIYVKTMLAAARFLQK
FT                   HFGGMWLLSRPFKSVFERYHSKVMTEADVRKILTLNRELDLGPHKQVIPYAYANKIIFD
FT                   EPDFIVVMDCPCRLHREHHCEPVTVCMAVGRYYGQLWLEHSQKFHPRKITQEEALELVR
FT                   SQREKGCITTAWVKVGTGGRTGIICNCCTCCCGGLEGMRMVKAIKGGENVSNVAPSGYK
FT                   VDHDPALCTACGTCISGCMFDAITADENGAPVYNRDACMGCGLCVEHCPRQARSLNKEF
FT                   AEGLFPLDLDMLQEKKQ"
     MKESTKRIIR YHGLRPDRAF HNWLYFAHYR IYVKTMLAAA RFLQKHFGGM WLLSRPFKSV        60
     FERYHSKVMT EADVRKILTL NRELDLGPHK QVIPYAYANK IIFDEPDFIV VMDCPCRLHR       120
     EHHCEPVTVC MAVGRYYGQL WLEHSQKFHP RKITQEEALE LVRSQREKGC ITTAWVKVGT       180
     GGRTGIICNC CTCCCGGLEG MRMVKAIKGG ENVSNVAPSG YKVDHDPALC TACGTCISGC       240
     MFDAITADEN GAPVYNRDAC MGCGLCVEHC PRQARSLNKE FAEGLFPLDL DMLQEKKQ         298
//

If you have problems or comments...

PBIL Back to PBIL home page