(data stored in ACNUC7421 zone)

EMBL: CP000859.PE562

CP000859.PE562       Location/Qualifiers
FT   CDS             631443..631751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66372"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU60"
FT                   /protein_id="ABW66372.1"
FT                   /translation="MAEQPKNSDWVFVAAEVAGDWAGRFVAYRDEVSDISYVPAFYKKE
FT                   EAQACFINLPREKGKKYEIQAVMFEDLAKDATANGCLIFMLDADGRILLKIDPATVD"
     MAEQPKNSDW VFVAAEVAGD WAGRFVAYRD EVSDISYVPA FYKKEEAQAC FINLPREKGK        60
     KYEIQAVMFE DLAKDATANG CLIFMLDADG RILLKIDPAT VD                          102
//

If you have problems or comments...

PBIL Back to PBIL home page