(data stored in ACNUC7421 zone)

EMBL: CP000859.PE564

CP000859.PE564       Location/Qualifiers
FT   CDS             complement(632711..633049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0564"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   gsu:GSU1836 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66374"
FT                   /db_xref="GOA:A8ZU62"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU62"
FT                   /protein_id="ABW66374.1"
FT                   /translation="MKKIEAIIKPFKLDDVKNVLNELGIQGMTVTEVKGYGRQKGHTEI
FT                   YRGAEYIVDFVPKIKLEVVVAASMADKVVDAIAKAALTGKVGDGKIFVMPVEQAVRVRT
FT                   GEKGKDAI"
     MKKIEAIIKP FKLDDVKNVL NELGIQGMTV TEVKGYGRQK GHTEIYRGAE YIVDFVPKIK        60
     LEVVVAASMA DKVVDAIAKA ALTGKVGDGK IFVMPVEQAV RVRTGEKGKD AI               112
//

If you have problems or comments...

PBIL Back to PBIL home page