(data stored in ACNUC7421 zone)

EMBL: CP000859.PE566

CP000859.PE566       Location/Qualifiers
FT   CDS             complement(634397..635680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0566"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: plt:Plut_0089 ammonium
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66376"
FT                   /db_xref="GOA:A8ZU64"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU64"
FT                   /protein_id="ABW66376.1"
FT                   /translation="MPALAAAPETVIDTGTTSWMLTSTALVLLMVPGLAMFYGGLVRTK
FT                   NVLGTMMHSFVAMAVIGVLWVVVGYALTFGKSVMGGVVGWNSDYFLLKGIDSSITNGVP
FT                   EYVLAMFQGKFAIITPALISGALAERVYFRGYILFIALWFLVIYCPLCHWVWAADGWLF
FT                   NLGAAGVIDLAGGTVIHVSAGVSALVIALMLGARRGYPQTPMLPNNMVMTMMGAGLLWV
FT                   GWFGFNAGSTVQSGLDTARALTMTQISAASGALTWLVIEALIYRKATSLGFVSGILAGL
FT                   VVITPAAGVVLPGGALVLGALSSMACYFALKAKNRLGYDDSLDCFGIHGVGSGLGVLLL
FT                   SFFIRDSWMKDAAEAAGGAWSAWNQLAVQLAGVGATVALAVVGTLAIYFVVEKSVGFRI
FT                   EEQGEVEGLDQFLHGENGYGLVRSDFIT"
     MPALAAAPET VIDTGTTSWM LTSTALVLLM VPGLAMFYGG LVRTKNVLGT MMHSFVAMAV        60
     IGVLWVVVGY ALTFGKSVMG GVVGWNSDYF LLKGIDSSIT NGVPEYVLAM FQGKFAIITP       120
     ALISGALAER VYFRGYILFI ALWFLVIYCP LCHWVWAADG WLFNLGAAGV IDLAGGTVIH       180
     VSAGVSALVI ALMLGARRGY PQTPMLPNNM VMTMMGAGLL WVGWFGFNAG STVQSGLDTA       240
     RALTMTQISA ASGALTWLVI EALIYRKATS LGFVSGILAG LVVITPAAGV VLPGGALVLG       300
     ALSSMACYFA LKAKNRLGYD DSLDCFGIHG VGSGLGVLLL SFFIRDSWMK DAAEAAGGAW       360
     SAWNQLAVQL AGVGATVALA VVGTLAIYFV VEKSVGFRIE EQGEVEGLDQ FLHGENGYGL       420
     VRSDFIT                                                                 427
//

If you have problems or comments...

PBIL Back to PBIL home page