(data stored in ACNUC7421 zone)

EMBL: CP000859.PE57

CP000859.PE57        Location/Qualifiers
FT   CDS             complement(64046..65218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0057"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: pth:PTH_0660 alanine racemase; TIGRFAM:
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65867"
FT                   /db_xref="GOA:A8ZRV0"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZRV0"
FT                   /protein_id="ABW65867.1"
FT                   /translation="MNDFSAWAEIDLDAVAHNVAALKALTRPACRLMAAVKADGYGHGM
FT                   CEVASVALESGASALGVSRIDEALDLRNHGITAPILVLGHTPAHRCREMVDQNLIQTVC
FT                   ALAEAQALSRAATAIGATVSVHLKVDTGMGRLGINTVVPGRTAPQEAAVKEALAVLDLP
FT                   GLAAEGVFTHFACADSADKTHANAQFKRFSTLIQELEAAGRPVAVRHAANSAALIDMPE
FT                   THLDMVRAGIAIYGLYPSAEVDRQKVALKPAMAFKTRVAQVKKVPAGFTVSYGATYTTP
FT                   KPTVLAVVSVGYADGLNRLLSSRGFMLVRGCRVPLVGRICMDLTMLDVGGVPDVAVGDE
FT                   VVIFGSQNGAFIGADEIADALNTISYEVVTSITGRVPRVYCNGSSSAVRR"
     MNDFSAWAEI DLDAVAHNVA ALKALTRPAC RLMAAVKADG YGHGMCEVAS VALESGASAL        60
     GVSRIDEALD LRNHGITAPI LVLGHTPAHR CREMVDQNLI QTVCALAEAQ ALSRAATAIG       120
     ATVSVHLKVD TGMGRLGINT VVPGRTAPQE AAVKEALAVL DLPGLAAEGV FTHFACADSA       180
     DKTHANAQFK RFSTLIQELE AAGRPVAVRH AANSAALIDM PETHLDMVRA GIAIYGLYPS       240
     AEVDRQKVAL KPAMAFKTRV AQVKKVPAGF TVSYGATYTT PKPTVLAVVS VGYADGLNRL       300
     LSSRGFMLVR GCRVPLVGRI CMDLTMLDVG GVPDVAVGDE VVIFGSQNGA FIGADEIADA       360
     LNTISYEVVT SITGRVPRVY CNGSSSAVRR                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page