(data stored in ACNUC7421 zone)

EMBL: CP000859.PE570

CP000859.PE570       Location/Qualifiers
FT   CDS             complement(640970..641386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0570"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   dde:Dde_3072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66380"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU68"
FT                   /protein_id="ABW66380.1"
FT                   /translation="MKTFRKELVFNVPTRRAFINITPEVEQCLSESGIQEGLVLVNAMH
FT                   ITASVFINDDESGLHYDYDQWLEKLAPHAPVSQYRHNVGEDNADAHMKRQIMGREVVVA
FT                   VTGGRLDFGTWEQIFYGEFDGRRPKRVLIKIIGE"
     MKTFRKELVF NVPTRRAFIN ITPEVEQCLS ESGIQEGLVL VNAMHITASV FINDDESGLH        60
     YDYDQWLEKL APHAPVSQYR HNVGEDNADA HMKRQIMGRE VVVAVTGGRL DFGTWEQIFY       120
     GEFDGRRPKR VLIKIIGE                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page