(data stored in ACNUC7421 zone)

EMBL: CP000859.PE573

CP000859.PE573       Location/Qualifiers
FT   CDS             643826..644344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0573"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_1581 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66383"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR035205"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU71"
FT                   /protein_id="ABW66383.1"
FT                   /translation="MLAEIKDGEVVSRRYESIDPVWISHLADRLRELGVDVLICGAISQ
FT                   TPSTIIEANGIRLIPFIGGAIEEVLNAFARSGRIASDFLMPGCGRGQRRQGRGACPRSY
FT                   KEVNAMPRSDRTGPQGLGPGTGRGRGPCQGGRTGTGTGQGTGQGQGQGRGQGRGQGAGN
FT                   GAGQGKRNR"
     MLAEIKDGEV VSRRYESIDP VWISHLADRL RELGVDVLIC GAISQTPSTI IEANGIRLIP        60
     FIGGAIEEVL NAFARSGRIA SDFLMPGCGR GQRRQGRGAC PRSYKEVNAM PRSDRTGPQG       120
     LGPGTGRGRG PCQGGRTGTG TGQGTGQGQG QGRGQGRGQG AGNGAGQGKR NR               172
//

If you have problems or comments...

PBIL Back to PBIL home page