(data stored in ACNUC7421 zone)

EMBL: CP000859.PE574

CP000859.PE574       Location/Qualifiers
FT   CDS             644529..644849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0574"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: sat:SYN_01170 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66384"
FT                   /db_xref="InterPro:IPR035205"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU72"
FT                   /protein_id="ABW66384.1"
FT                   /translation="MPGYNGTGPMGAGPMTGGARGYCSPAAAGQRGTGFGFGRGMAYRR
FT                   GGGFGPGRGAGGGYGRRFAGPQAPYGVSPTDEAAALKQQAQAMQNSLDAISARLAELEK
FT                   EE"
     MPGYNGTGPM GAGPMTGGAR GYCSPAAAGQ RGTGFGFGRG MAYRRGGGFG PGRGAGGGYG        60
     RRFAGPQAPY GVSPTDEAAA LKQQAQAMQN SLDAISARLA ELEKEE                      106
//

If you have problems or comments...

PBIL Back to PBIL home page