(data stored in ACNUC7421 zone)

EMBL: CP000859.PE576

CP000859.PE576       Location/Qualifiers
FT   CDS             645626..646480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0576"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; Cobyrinic acid ac-diamide synthase; KEGG:
FT                   dps:DP0339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66386"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU74"
FT                   /protein_id="ABW66386.1"
FT                   /translation="MIISVASGKGGTGKTTVATNLAVALGPDVQVLDCDVEEPNAHLFL
FT                   KPAFTDMEAVMVMVPAVDEEKCTYCRKCAEICRFRAIAVLGETILTFPELCHSCGGCIE
FT                   VCPEDAVYETSRKVGVVERGTGVGDTAFVHGRLRVSEAMAPPLIKRVRAYTRPSGLTII
FT                   DAPPGTSCPVIASVKDADFVVMVTEPTPFGLHDLKLGVEAVRMLGLPCGLVINRSDIGN
FT                   DEVWRYAEAENLPILMEMPFDRGIAEAYSRGEMVVERFPEWREKFVDMYGRITQLVEKG
FT                   GRK"
     MIISVASGKG GTGKTTVATN LAVALGPDVQ VLDCDVEEPN AHLFLKPAFT DMEAVMVMVP        60
     AVDEEKCTYC RKCAEICRFR AIAVLGETIL TFPELCHSCG GCIEVCPEDA VYETSRKVGV       120
     VERGTGVGDT AFVHGRLRVS EAMAPPLIKR VRAYTRPSGL TIIDAPPGTS CPVIASVKDA       180
     DFVVMVTEPT PFGLHDLKLG VEAVRMLGLP CGLVINRSDI GNDEVWRYAE AENLPILMEM       240
     PFDRGIAEAY SRGEMVVERF PEWREKFVDM YGRITQLVEK GGRK                        284
//

If you have problems or comments...

PBIL Back to PBIL home page