(data stored in ACNUC7421 zone)

EMBL: CP000859.PE578

CP000859.PE578       Location/Qualifiers
FT   CDS             647434..647817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0578"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: sat:SYN_01180 dinitrogenase
FT                   iron-molybdenum cofactor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66388"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU76"
FT                   /protein_id="ABW66388.1"
FT                   /translation="MKDGRIAVPSNGAGGLDGTRSGHFGHCDVFTLVDVKDGQIAQVST
FT                   ISNQEHVQGGCMVPVNLLAEHRVNALVVGGIGMRPLAGFRQVGIDVYHDDQRPEIRPVV
FT                   EDLIAGKLLQIRDDQVCGGGGGH"
     MKDGRIAVPS NGAGGLDGTR SGHFGHCDVF TLVDVKDGQI AQVSTISNQE HVQGGCMVPV        60
     NLLAEHRVNA LVVGGIGMRP LAGFRQVGID VYHDDQRPEI RPVVEDLIAG KLLQIRDDQV       120
     CGGGGGH                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page