(data stored in ACNUC7421 zone)

EMBL: CP000859.PE580

CP000859.PE580       Location/Qualifiers
FT   CDS             648853..649197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0580"
FT                   /product="Protein of unknown function CGGC region"
FT                   /note="PFAM: Protein of unknown function CGGC region; KEGG:
FT                   afu:AF1756 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66390"
FT                   /db_xref="InterPro:IPR014925"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU78"
FT                   /protein_id="ABW66390.1"
FT                   /translation="MEKVAVVGCGAYMDNGYGCPGEWRCLKAAALGEGKFEAPATVVAF
FT                   IKCECPGRCLVPNVGMAMKLSEIKPDRIYLSSCLANAKPGCPYSNAEEMAKMIEGKFGI
FT                   PVVTGTHDYH"
     MEKVAVVGCG AYMDNGYGCP GEWRCLKAAA LGEGKFEAPA TVVAFIKCEC PGRCLVPNVG        60
     MAMKLSEIKP DRIYLSSCLA NAKPGCPYSN AEEMAKMIEG KFGIPVVTGT HDYH             114
//

If you have problems or comments...

PBIL Back to PBIL home page