(data stored in ACNUC7421 zone)

EMBL: CP000859.PE582

CP000859.PE582       Location/Qualifiers
FT   CDS             649872..651311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0582"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lpf:lpl1943 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66392"
FT                   /db_xref="GOA:A8ZU80"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU80"
FT                   /protein_id="ABW66392.1"
FT                   /translation="MRVNQAVEPAPTSLEAEKAQQSLWRLLPRFRGTPWFDQLLANEFL
FT                   PPDVQERRQLAMLQRTVARAFETVPYYGDRFQAAFGRPDIGRLSDLARLPVLTRLDIQA
FT                   HFDRMQSTALKPGQPMLPTQTSGSTGQPVTVLHTVESRRMFGLLKQRELRWFRWNPEKT
FT                   LAAVRSANEIPFSDDNRTAFENTFFCQTPHWPVIGSCFHTGPFCGMSCTAPLETQVRWL
FT                   DHVQPHYLMVIASKLEHLAFGYQQRPVPETLEAALSISQELTPRMRAFVEAVFRVPVHQ
FT                   NYGINEVGIIASRCPEGGRYHVNTELCVVEIVDADGQPCKPGQKGRLLVTALANDAMPL
FT                   IRYDTGDLAEAMEGPCPCGRTLPSFGMVHGRYNSIVSLPDGYWNYWIAFVGNFSSMPSH
FT                   LMQYIRQFQMHLFRDNIFELRLALTPGRPEALIEYVKSAWRPDTDNPPAMRIVEVDGFP
FT                   EPANGKFQMFTSDYITQPPIK"
     MRVNQAVEPA PTSLEAEKAQ QSLWRLLPRF RGTPWFDQLL ANEFLPPDVQ ERRQLAMLQR        60
     TVARAFETVP YYGDRFQAAF GRPDIGRLSD LARLPVLTRL DIQAHFDRMQ STALKPGQPM       120
     LPTQTSGSTG QPVTVLHTVE SRRMFGLLKQ RELRWFRWNP EKTLAAVRSA NEIPFSDDNR       180
     TAFENTFFCQ TPHWPVIGSC FHTGPFCGMS CTAPLETQVR WLDHVQPHYL MVIASKLEHL       240
     AFGYQQRPVP ETLEAALSIS QELTPRMRAF VEAVFRVPVH QNYGINEVGI IASRCPEGGR       300
     YHVNTELCVV EIVDADGQPC KPGQKGRLLV TALANDAMPL IRYDTGDLAE AMEGPCPCGR       360
     TLPSFGMVHG RYNSIVSLPD GYWNYWIAFV GNFSSMPSHL MQYIRQFQMH LFRDNIFELR       420
     LALTPGRPEA LIEYVKSAWR PDTDNPPAMR IVEVDGFPEP ANGKFQMFTS DYITQPPIK        479
//

If you have problems or comments...

PBIL Back to PBIL home page