(data stored in ACNUC7421 zone)

EMBL: CP000859.PE59

CP000859.PE59        Location/Qualifiers
FT   CDS             complement(65937..67118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0059"
FT                   /product="arginine biosynthesis bifunctional protein ArgJ"
FT                   /EC_number="2.3.1.1"
FT                   /note="KEGG: gsu:GSU2049 amino-acid N-acetyltransferase /
FT                   glutamate N-acetyltransferase; TIGRFAM: arginine
FT                   biosynthesis bifunctional protein ArgJ; PFAM: arginine
FT                   biosynthesis protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65869"
FT                   /db_xref="GOA:A8ZRV2"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRV2"
FT                   /protein_id="ABW65869.1"
FT                   /translation="MECPGFQWAGVCAGIKNLKKKDLGLLVSDTPAAVAAVFTANRVKA
FT                   APVLLDMERVASGRCRAIVANSGNANCCTGDAGMAAALAMTKAVAEALGIDEALVLVAS
FT                   TGVIGAPMPTETITGAVPGLVKALRPDGLPDFSESILTTDRFAKSALRNVRLENGTTVT
FT                   VCATAKGAGMIRPDMATMLCFVCTDLQADTDALSGMLSVAVDRSFNRITVDGDTSTNDT
FT                   VFLMAGGASGAGLQTDADRQGFQQALDDVLTELARMMVTDGEGATKLVEVRVKGAKSDA
FT                   DARRVADTVANSSLVKTAFFGQDANWGRIMAAAGRAGVDLSPDAVDIFFDDVQMVKNGM
FT                   GCGPEAERKASGVLKQPTICLGIDLNTGGTGAATVLTCDLSIEYVKINADYRT"
     MECPGFQWAG VCAGIKNLKK KDLGLLVSDT PAAVAAVFTA NRVKAAPVLL DMERVASGRC        60
     RAIVANSGNA NCCTGDAGMA AALAMTKAVA EALGIDEALV LVASTGVIGA PMPTETITGA       120
     VPGLVKALRP DGLPDFSESI LTTDRFAKSA LRNVRLENGT TVTVCATAKG AGMIRPDMAT       180
     MLCFVCTDLQ ADTDALSGML SVAVDRSFNR ITVDGDTSTN DTVFLMAGGA SGAGLQTDAD       240
     RQGFQQALDD VLTELARMMV TDGEGATKLV EVRVKGAKSD ADARRVADTV ANSSLVKTAF       300
     FGQDANWGRI MAAAGRAGVD LSPDAVDIFF DDVQMVKNGM GCGPEAERKA SGVLKQPTIC       360
     LGIDLNTGGT GAATVLTCDL SIEYVKINAD YRT                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page