(data stored in ACNUC7421 zone)

EMBL: CP000859.PE593

CP000859.PE593       Location/Qualifiers
FT   CDS             664193..665026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0593"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC; KEGG: gur:Gura_2860 rod
FT                   shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66403"
FT                   /db_xref="GOA:A8ZU91"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU91"
FT                   /protein_id="ABW66403.1"
FT                   /translation="MFSRRMLVIVGIAGMLIVSLVFFAVTGRRATYPVSGGGVGMLVVA
FT                   PIQEMVTGSARFVRNTWRRYFALVSVAHENERLTDALAREIAENNRYREMELSSRRLRE
FT                   LLNFYETVDVKSFAAEVVARDPSGWFNTVIIDKGSTHGVRRSMPVVVDEGIVGQVVDTS
FT                   RYYAKVLLIIDPNSSVDGLCQRTRARGVVKGTIHERCDFMYVLRKDDVRVGDSVISSGL
FT                   DGIYPKGLPIGRVSAVVKRNAGIFQTVEVDPYVDFGKLEEVLVILNAPRHEFQDM"
     MFSRRMLVIV GIAGMLIVSL VFFAVTGRRA TYPVSGGGVG MLVVAPIQEM VTGSARFVRN        60
     TWRRYFALVS VAHENERLTD ALAREIAENN RYREMELSSR RLRELLNFYE TVDVKSFAAE       120
     VVARDPSGWF NTVIIDKGST HGVRRSMPVV VDEGIVGQVV DTSRYYAKVL LIIDPNSSVD       180
     GLCQRTRARG VVKGTIHERC DFMYVLRKDD VRVGDSVISS GLDGIYPKGL PIGRVSAVVK       240
     RNAGIFQTVE VDPYVDFGKL EEVLVILNAP RHEFQDM                                277
//

If you have problems or comments...

PBIL Back to PBIL home page