(data stored in ACNUC7421 zone)

EMBL: CP000859.PE595

CP000859.PE595       Location/Qualifiers
FT   CDS             665691..667595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0595"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain; KEGG:
FT                   sfu:Sfum_2589 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66405"
FT                   /db_xref="GOA:A8ZU93"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZU93"
FT                   /protein_id="ABW66405.1"
FT                   /translation="MTRGAAQRRYWAFYKAIRIFRVEDYFATLDADWFKHRLVALSLCV
FT                   AGVFVVLFARLFFLQVVEGEEYRRLSENNCIRLQRIEPPRGQIFDRNGVNIVDNRPSFD
FT                   LSIIPKDAGNPGKIIERLVALTGIPAARLHGNFVKHKTVNPYKPVLLAQDVGRDVLAVV
FT                   EGHRFDLPGVVMDVTPRRQYLYNGFAAHLIGYLGEISRNELGSDRFAGYEPGSYVGKYG
FT                   AERLYEPFLRGRYGGRQVEVNAGGNVVRVLKTVEAESGHHVYLTLDFNLQQKAEALMAG
FT                   VSGAVIALDPDTGAVLAMVSSPSFPQSRFVDGMSAEEWQALVTDPRRPMENKAIQAEYP
FT                   PASVYKIVTSFAGLEEAVVEPDTTFYCPGYYRYGDRVYRCWAEQGHGRVSVVDALARSC
FT                   DVYYYQVGQRVGVERLSWYAKACGLGRPTGIDLYPEKGGLVPSGQWKRRRLGTAWQGGE
FT                   TLSVAIGQSYNLVTPLQMAVLTAAVANGGVLKRPVILDRVETVEKERLKEGEPRDMGML
FT                   PVSDATLEIVRQGMWKAVNDRHGTAWWSARSRKVEISGKTGTAQVVASPRNGDEEIYAV
FT                   DTHKPHAWFVAYAPSENPVIAVAVIVEHGEHGSSAAGPVAKAMIETYLSDKGGSTDGR"
     MTRGAAQRRY WAFYKAIRIF RVEDYFATLD ADWFKHRLVA LSLCVAGVFV VLFARLFFLQ        60
     VVEGEEYRRL SENNCIRLQR IEPPRGQIFD RNGVNIVDNR PSFDLSIIPK DAGNPGKIIE       120
     RLVALTGIPA ARLHGNFVKH KTVNPYKPVL LAQDVGRDVL AVVEGHRFDL PGVVMDVTPR       180
     RQYLYNGFAA HLIGYLGEIS RNELGSDRFA GYEPGSYVGK YGAERLYEPF LRGRYGGRQV       240
     EVNAGGNVVR VLKTVEAESG HHVYLTLDFN LQQKAEALMA GVSGAVIALD PDTGAVLAMV       300
     SSPSFPQSRF VDGMSAEEWQ ALVTDPRRPM ENKAIQAEYP PASVYKIVTS FAGLEEAVVE       360
     PDTTFYCPGY YRYGDRVYRC WAEQGHGRVS VVDALARSCD VYYYQVGQRV GVERLSWYAK       420
     ACGLGRPTGI DLYPEKGGLV PSGQWKRRRL GTAWQGGETL SVAIGQSYNL VTPLQMAVLT       480
     AAVANGGVLK RPVILDRVET VEKERLKEGE PRDMGMLPVS DATLEIVRQG MWKAVNDRHG       540
     TAWWSARSRK VEISGKTGTA QVVASPRNGD EEIYAVDTHK PHAWFVAYAP SENPVIAVAV       600
     IVEHGEHGSS AAGPVAKAMI ETYLSDKGGS TDGR                                   634
//

If you have problems or comments...

PBIL Back to PBIL home page