(data stored in ACNUC7421 zone)

EMBL: CP000859.PE6

CP000859.PE6         Location/Qualifiers
FT   CDS             complement(5815..7230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0006"
FT                   /product="replicative DNA helicase"
FT                   /note="TIGRFAM: replicative DNA helicase; PFAM: DnaB domain
FT                   protein helicase domain protein; KEGG: sat:SYN_00640
FT                   replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65816"
FT                   /db_xref="GOA:A8ZRP9"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRP9"
FT                   /protein_id="ABW65816.1"
FT                   /translation="MEKAAPKKKGRPKAGAAGAVPSDPLLHRLPPQNIEAEESILSTIL
FT                   IDPDPSTLFDVLEVLAPEDFYKSAHQKIFAAIVRLVEKNEPVDLVTVKNTLAESDELEP
FT                   IGGAAYLAGLVDSAPYAANARHYADIIKNKASLRRMIENANEISRRCFDNPSDVEGVID
FT                   FAERAILEVAEQKAGRSFYKLSQLLVANIETIEANQGKGITGIPSGFDRLDNLTAGFQK
FT                   SDLIILAARPSMGKTAFALNIARNVAVDANVPVAVFSLEMSKEQLSMRLLTAEARIGFQ
FT                   RLRSGYTSRQDMGQITDAASVLEQAPLFIDDSPGLTAMEIRAKARRLKREKGIGMIVVD
FT                   YLQLMRASHQGERRDLEVSEMSRSLKGLAKELDLPILVLSQLNRSPEQSQDKRPMLSHL
FT                   RESGSLEQDADVVLFIYRDEMYNKEPENPNRGSAEIIIGKQRNGPVGKIKLQFSADITR
FT                   FHDLETVHADMEA"
     MEKAAPKKKG RPKAGAAGAV PSDPLLHRLP PQNIEAEESI LSTILIDPDP STLFDVLEVL        60
     APEDFYKSAH QKIFAAIVRL VEKNEPVDLV TVKNTLAESD ELEPIGGAAY LAGLVDSAPY       120
     AANARHYADI IKNKASLRRM IENANEISRR CFDNPSDVEG VIDFAERAIL EVAEQKAGRS       180
     FYKLSQLLVA NIETIEANQG KGITGIPSGF DRLDNLTAGF QKSDLIILAA RPSMGKTAFA       240
     LNIARNVAVD ANVPVAVFSL EMSKEQLSMR LLTAEARIGF QRLRSGYTSR QDMGQITDAA       300
     SVLEQAPLFI DDSPGLTAME IRAKARRLKR EKGIGMIVVD YLQLMRASHQ GERRDLEVSE       360
     MSRSLKGLAK ELDLPILVLS QLNRSPEQSQ DKRPMLSHLR ESGSLEQDAD VVLFIYRDEM       420
     YNKEPENPNR GSAEIIIGKQ RNGPVGKIKL QFSADITRFH DLETVHADME A                471
//

If you have problems or comments...

PBIL Back to PBIL home page