(data stored in ACNUC7421 zone)

EMBL: CP000859.PE60

CP000859.PE60        Location/Qualifiers
FT   CDS             complement(67250..67978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0060"
FT                   /product="Vitamin B12 dependent methionine synthase
FT                   activation region"
FT                   /note="PFAM: Vitamin B12 dependent methionine synthase
FT                   activation region; KEGG: bth:BT_0342 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65870"
FT                   /db_xref="GOA:A8ZRV3"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRV3"
FT                   /protein_id="ABW65870.1"
FT                   /translation="MTLFDDATFDAGFCFTGFDPEALGLDLCAENCLELVARRIGYGPD
FT                   TLPVGEKAGRIKTVIAQGIEAVALAGQGKPVTIDRWSGKEVVAGPVCVQSPRWSHVVRQ
FT                   AQEPQALYGFILTLGRDFDRVKEKAALFDAYVLDALGSEMVEQAADRVEQRIRAWCATR
FT                   NRVCSRRFSPGYCDWPLAQGQQALGDFLAPAAIGVKVLASGAMVPSKSITGAVIMARSL
FT                   PLSCPCPVCNQANCAYRRVA"
     MTLFDDATFD AGFCFTGFDP EALGLDLCAE NCLELVARRI GYGPDTLPVG EKAGRIKTVI        60
     AQGIEAVALA GQGKPVTIDR WSGKEVVAGP VCVQSPRWSH VVRQAQEPQA LYGFILTLGR       120
     DFDRVKEKAA LFDAYVLDAL GSEMVEQAAD RVEQRIRAWC ATRNRVCSRR FSPGYCDWPL       180
     AQGQQALGDF LAPAAIGVKV LASGAMVPSK SITGAVIMAR SLPLSCPCPV CNQANCAYRR       240
     VA                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page