(data stored in ACNUC7421 zone)

EMBL: CP000859.PE602

CP000859.PE602       Location/Qualifiers
FT   CDS             672566..673462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0602"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: dde:Dde_0986 ATP synthase F1, gamma subunit;
FT                   TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+transporting two-sector ATPase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66412"
FT                   /db_xref="GOA:A8ZUA0"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZUA0"
FT                   /protein_id="ABW66412.1"
FT                   /translation="MPSLKEVQLKIKGVKQTKKITKAMNMVATSKLRGAQTNMEAFRPY
FT                   AEKFAEVLGSLAAKAGEETSPLLVPKESVKRVNVVLCTSDRGLCGGFNTNLVRMANAYL
FT                   KRCQEKEIEVSFTHFGKKGRDWCRKMTDCERKSEYLGVVGARFGFNVAVTAGRELINGF
FT                   LNGDYDEVHVIYSEFQGMAKQLPVIRQLLPIPPIETADSPASDGGEDYLAEHICEPSPD
FT                   EILDAMLPKNVFIQIYSALLETSTSEHAARMAAMDNASKACNDMINELTLLYNKARQAA
FT                   ITAELMDIVGGAEALKG"
     MPSLKEVQLK IKGVKQTKKI TKAMNMVATS KLRGAQTNME AFRPYAEKFA EVLGSLAAKA        60
     GEETSPLLVP KESVKRVNVV LCTSDRGLCG GFNTNLVRMA NAYLKRCQEK EIEVSFTHFG       120
     KKGRDWCRKM TDCERKSEYL GVVGARFGFN VAVTAGRELI NGFLNGDYDE VHVIYSEFQG       180
     MAKQLPVIRQ LLPIPPIETA DSPASDGGED YLAEHICEPS PDEILDAMLP KNVFIQIYSA       240
     LLETSTSEHA ARMAAMDNAS KACNDMINEL TLLYNKARQA AITAELMDIV GGAEALKG         298
//

If you have problems or comments...

PBIL Back to PBIL home page