(data stored in ACNUC7421 zone)

EMBL: CP000859.PE603

CP000859.PE603       Location/Qualifiers
FT   CDS             673501..674904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0603"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /note="KEGG: sfu:Sfum_2582 ATP synthase F1, beta subunit;
FT                   TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66413"
FT                   /db_xref="GOA:A8ZUA1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZUA1"
FT                   /protein_id="ABW66413.1"
FT                   /translation="MSDNIGKVVQVMGPVVDVEFEPGKLPAILTALLITNTVINDEADN
FT                   LVVEVAQHLGDNVVRTIAMDVTDGLVRGMPVKDTGAPITMPVGAASLGRVLNVVGKPVD
FT                   GLGPVSREKTMPIHRPAPLFTEQDTSVNVLETGIKVIDLLVPFPRGGKMGLFGGAGVGK
FT                   TVIMMEMVNNIAMQHGGISVFAGVGERTREGNDLYHEMKDSGVLPKAALIYGQMTEPPG
FT                   ARARVALSALTCAEYFRDVEGQDVLIFIDNIFRFTQAGAEVSALLGRIPSAVGYQPTLA
FT                   VDLGGLQERITSTDKGSITAVQCVYVPADDLTDPAPATTFAHLDGTVVLSRQIAELGIY
FT                   PSVDPLDSTSRILDAAYIGEEHYRVAREVQQTLQKYKELQDIIAILGMDELSDEDKVTV
FT                   ERARKLQRFLSQPFHVAEVFTGKPGSYVKIEDTVRSFKEICDGKHDDLPESAFYMVGSI
FT                   EEAVAKAKG"
     MSDNIGKVVQ VMGPVVDVEF EPGKLPAILT ALLITNTVIN DEADNLVVEV AQHLGDNVVR        60
     TIAMDVTDGL VRGMPVKDTG APITMPVGAA SLGRVLNVVG KPVDGLGPVS REKTMPIHRP       120
     APLFTEQDTS VNVLETGIKV IDLLVPFPRG GKMGLFGGAG VGKTVIMMEM VNNIAMQHGG       180
     ISVFAGVGER TREGNDLYHE MKDSGVLPKA ALIYGQMTEP PGARARVALS ALTCAEYFRD       240
     VEGQDVLIFI DNIFRFTQAG AEVSALLGRI PSAVGYQPTL AVDLGGLQER ITSTDKGSIT       300
     AVQCVYVPAD DLTDPAPATT FAHLDGTVVL SRQIAELGIY PSVDPLDSTS RILDAAYIGE       360
     EHYRVAREVQ QTLQKYKELQ DIIAILGMDE LSDEDKVTVE RARKLQRFLS QPFHVAEVFT       420
     GKPGSYVKIE DTVRSFKEIC DGKHDDLPES AFYMVGSIEE AVAKAKG                     467
//

If you have problems or comments...

PBIL Back to PBIL home page