(data stored in ACNUC7421 zone)

EMBL: CP000859.PE607

CP000859.PE607       Location/Qualifiers
FT   CDS             676602..676892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66417"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZUA5"
FT                   /protein_id="ABW66417.1"
FT                   /translation="MGEHITIHLFGKSYTFEADADVPNAHAVADLLEQEVTVVAKKAGG
FT                   TAISRNPFAMLTQAALNIANECVGLRSDRHRMVQAVTTRSQALIQAMDARL"
     MGEHITIHLF GKSYTFEADA DVPNAHAVAD LLEQEVTVVA KKAGGTAISR NPFAMLTQAA        60
     LNIANECVGL RSDRHRMVQA VTTRSQALIQ AMDARL                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page