(data stored in ACNUC7421 zone)

EMBL: CP000859.PE610

CP000859.PE610       Location/Qualifiers
FT   CDS             686449..688872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0610"
FT                   /product="exporter of the RND superfamily protein-like
FT                   protein"
FT                   /note="KEGG: pgi:PG1180 membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66420"
FT                   /db_xref="GOA:A8ZUK7"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZUK7"
FT                   /protein_id="ABW66420.1"
FT                   /translation="MNNDAHGYAFKTGRVDLLNRWFERIGGGAYHYRWAVLLLCAVLLC
FT                   CGAWAASLVRFDNSFKSYFDQNDPAYKAFLEFREVFGSDEISYILYQAPDAAHGIWNME
FT                   VMQKIRDLTRRLKQEVPFVKEVTSLANAEFVEGVEGDLLVHDVLEDFPETQAALLAIRQ
FT                   KILNKPIYINGLVSRDGTYGAILVEMEKASVDALEEIRFDPGKGDALENLYPQVTYDRI
FT                   ETILAMPEYEGIRFYHTGDVPLNAAYNRISQQESTRLAIISFAVIGGVLLFFFRSVRGV
FT                   AGPLVVVLCAMLASVGFMAVFSWDMDLMFIMLPALLVAVGVADAVHVLSEFNIYYQKYG
FT                   DRKAAVKKALFLVGVPCLFTSLTTMAGFASMSISPIKAIKHFAIYSAVGVGAAFLLSVT
FT                   MLVVFLSFGRRRKEPGRQDRQNRVSHLAAAFLGGLARCNVRYKTTILAGFAVIFVLSLA
FT                   GMTRLQVDSNFISEFSKRAPIRQVTEHVDSVMGGSTSFSYVFDSGTPDGVTDPAFLKRI
FT                   EALQRAAEKKPVVMKAYSVVDMIKDINREFHNGDPSYYRIPDTQEEAAQLLLVYEMSGG
FT                   EELDDYLSGDFQKARLELRCQAVATSQYKSMVDELGTFLVSSGAEKEDLPVLAGMGTLW
FT                   LTLLDYITKSQIIGFLVAFSVIAGMMCVVLGSVRVGLLSMVPNLTPVVITLGLMGWAGI
FT                   PLDYVKLLIASIAIGIAVDDTVHMVIRYRHEFARHRNYQEALLAAMLGVGRALLVTSVV
FT                   LVAGFLVFTGSIMQTLSDFGILVACTIAVALLADFLLLPSLVLTLKPFGEENTV"
     MNNDAHGYAF KTGRVDLLNR WFERIGGGAY HYRWAVLLLC AVLLCCGAWA ASLVRFDNSF        60
     KSYFDQNDPA YKAFLEFREV FGSDEISYIL YQAPDAAHGI WNMEVMQKIR DLTRRLKQEV       120
     PFVKEVTSLA NAEFVEGVEG DLLVHDVLED FPETQAALLA IRQKILNKPI YINGLVSRDG       180
     TYGAILVEME KASVDALEEI RFDPGKGDAL ENLYPQVTYD RIETILAMPE YEGIRFYHTG       240
     DVPLNAAYNR ISQQESTRLA IISFAVIGGV LLFFFRSVRG VAGPLVVVLC AMLASVGFMA       300
     VFSWDMDLMF IMLPALLVAV GVADAVHVLS EFNIYYQKYG DRKAAVKKAL FLVGVPCLFT       360
     SLTTMAGFAS MSISPIKAIK HFAIYSAVGV GAAFLLSVTM LVVFLSFGRR RKEPGRQDRQ       420
     NRVSHLAAAF LGGLARCNVR YKTTILAGFA VIFVLSLAGM TRLQVDSNFI SEFSKRAPIR       480
     QVTEHVDSVM GGSTSFSYVF DSGTPDGVTD PAFLKRIEAL QRAAEKKPVV MKAYSVVDMI       540
     KDINREFHNG DPSYYRIPDT QEEAAQLLLV YEMSGGEELD DYLSGDFQKA RLELRCQAVA       600
     TSQYKSMVDE LGTFLVSSGA EKEDLPVLAG MGTLWLTLLD YITKSQIIGF LVAFSVIAGM       660
     MCVVLGSVRV GLLSMVPNLT PVVITLGLMG WAGIPLDYVK LLIASIAIGI AVDDTVHMVI       720
     RYRHEFARHR NYQEALLAAM LGVGRALLVT SVVLVAGFLV FTGSIMQTLS DFGILVACTI       780
     AVALLADFLL LPSLVLTLKP FGEENTV                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page