(data stored in ACNUC7421 zone)

EMBL: CP000859.PE611

CP000859.PE611       Location/Qualifiers
FT   CDS             689453..690847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0611"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   family"
FT                   /note="TIGRFAM: type I secretion outer membrane protein,
FT                   TolC family; PFAM: outer membrane efflux protein; KEGG:
FT                   aeh:Mlg_2639 type I secretion outer membrane protein, TolC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABW66421"
FT                   /db_xref="GOA:A8ZUK8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZUK8"
FT                   /protein_id="ABW66421.1"
FT                   /translation="MEKAVSARRCVRRKIVSGITTGALTVALLCLAGVPSVLYAADLMT
FT                   VFNQALENDPRFVGMRHERDAEQERLRQAWAGVLPSLSAEGVHKETAQDIVSSDNTVFG
FT                   SGSSDFPTTEYTLSLTQPLFNLSSFINIRRASALVRGADLELEAARQELAVRVAQAYFH
FT                   ALAARDRLTATAAEEAAVGGHYELVNERFNRGLSTRTEYYDAKARLADIMARRLTAESD
FT                   LDDAYQALAEITGSPVEDLSLLHEELPLVSPDPVDADAWIEAAVRQNPSLEAVRQSVAS
FT                   ARQEVRRQRAGHYPNVNLEASHNWRETDGTLFGGGSEVETSEILFRLNVPLYQGGMVNS
FT                   RTREAICRMNALLQEESRQTRALQRETRAAFYGVDNAIERVRSLRDAVEAQQLALEGKK
FT                   EGHRSGLFTVLAVLDAERDLSLARQNYAMARYDYIINSLVLKKTVGTLDDANIAGVNGW
FT                   LRNVSE"
     MEKAVSARRC VRRKIVSGIT TGALTVALLC LAGVPSVLYA ADLMTVFNQA LENDPRFVGM        60
     RHERDAEQER LRQAWAGVLP SLSAEGVHKE TAQDIVSSDN TVFGSGSSDF PTTEYTLSLT       120
     QPLFNLSSFI NIRRASALVR GADLELEAAR QELAVRVAQA YFHALAARDR LTATAAEEAA       180
     VGGHYELVNE RFNRGLSTRT EYYDAKARLA DIMARRLTAE SDLDDAYQAL AEITGSPVED       240
     LSLLHEELPL VSPDPVDADA WIEAAVRQNP SLEAVRQSVA SARQEVRRQR AGHYPNVNLE       300
     ASHNWRETDG TLFGGGSEVE TSEILFRLNV PLYQGGMVNS RTREAICRMN ALLQEESRQT       360
     RALQRETRAA FYGVDNAIER VRSLRDAVEA QQLALEGKKE GHRSGLFTVL AVLDAERDLS       420
     LARQNYAMAR YDYIINSLVL KKTVGTLDDA NIAGVNGWLR NVSE                        464
//

If you have problems or comments...

PBIL Back to PBIL home page