(data stored in ACNUC7421 zone)

EMBL: CP000859.PE68

CP000859.PE68        Location/Qualifiers
FT   CDS             complement(75864..77306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0068"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; KEGG: sat:SYN_02776
FT                   tRNA(Ile)-lysidine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65878"
FT                   /db_xref="GOA:A8ZRW1"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRW1"
FT                   /protein_id="ABW65878.1"
FT                   /translation="MEKNSWLEKTDPLLDAVCRTIGCHAMIAPGEAVLVGVSGGPDSVA
FT                   LLHALVRLQPELAVARVSVAHVHHGLRGAEADADQAFVAALAERLGLPFYTEKIDVAAA
FT                   ARNTGASVEDAARTARYRFFSDTAAAHGYHKIATAHHAGDNAEWVLMNLVRGAGPEGLS
FT                   GIPPVRENIIRPLIHVSREDILAFLTHGGMDYVEDSTNADLTFTRNRVRHHLLPLIEEH
FT                   YNPGIAACLNRVAEIFREESLWIRDMVSGLFEQAVLLCEPGRVVLKAGFVQALPLAARR
FT                   RLVRRVLEIVKGDLRRITFDHAEAVCRGVDRTFGLDLPDAVHVSGNEQELVFSDTAVCP
FT                   ATATPQVKPFSYTLFDTGLGNGSVTITETGITLGFALAPCAAPANLQHNDRRTALLDAE
FT                   KLTCPLTIRNVRPGDRFVPLGMTGSQKVSDFFINTRVAPIDRAACPVVESGGAIVWVAG
FT                   HRMAEHVKLTPASRQVLKAKIL"
     MEKNSWLEKT DPLLDAVCRT IGCHAMIAPG EAVLVGVSGG PDSVALLHAL VRLQPELAVA        60
     RVSVAHVHHG LRGAEADADQ AFVAALAERL GLPFYTEKID VAAAARNTGA SVEDAARTAR       120
     YRFFSDTAAA HGYHKIATAH HAGDNAEWVL MNLVRGAGPE GLSGIPPVRE NIIRPLIHVS       180
     REDILAFLTH GGMDYVEDST NADLTFTRNR VRHHLLPLIE EHYNPGIAAC LNRVAEIFRE       240
     ESLWIRDMVS GLFEQAVLLC EPGRVVLKAG FVQALPLAAR RRLVRRVLEI VKGDLRRITF       300
     DHAEAVCRGV DRTFGLDLPD AVHVSGNEQE LVFSDTAVCP ATATPQVKPF SYTLFDTGLG       360
     NGSVTITETG ITLGFALAPC AAPANLQHND RRTALLDAEK LTCPLTIRNV RPGDRFVPLG       420
     MTGSQKVSDF FINTRVAPID RAACPVVESG GAIVWVAGHR MAEHVKLTPA SRQVLKAKIL       480
//

If you have problems or comments...

PBIL Back to PBIL home page