(data stored in ACNUC7421 zone)

EMBL: CP000859.PE69

CP000859.PE69        Location/Qualifiers
FT   CDS             77706..78359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0069"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: pca:Pcar_0108 GrpE
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65879"
FT                   /db_xref="GOA:A8ZRW2"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRW2"
FT                   /protein_id="ABW65879.1"
FT                   /translation="MSKKIRIRDDNTRAQEPEMAEEADLNTEDWPEEASPKAETDTGPD
FT                   QEVQEEDPIEVLDQQLEAALEEKKKVEDKLLRAAAEFDNYKKRLEKQWADFKKYAHEAV
FT                   IRELLSVVDNLERAIVASKDTADQNECLLSGVDMTLTEILKVFEKFGVTRIDALGRSFD
FT                   PNFHEAVARRETDDTDANIVIEEYQKGYMIHDRLLRPAMVVVSAGRKNGNSAGG"
     MSKKIRIRDD NTRAQEPEMA EEADLNTEDW PEEASPKAET DTGPDQEVQE EDPIEVLDQQ        60
     LEAALEEKKK VEDKLLRAAA EFDNYKKRLE KQWADFKKYA HEAVIRELLS VVDNLERAIV       120
     ASKDTADQNE CLLSGVDMTL TEILKVFEKF GVTRIDALGR SFDPNFHEAV ARRETDDTDA       180
     NIVIEEYQKG YMIHDRLLRP AMVVVSAGRK NGNSAGG                                217
//

If you have problems or comments...

PBIL Back to PBIL home page