(data stored in ACNUC7421 zone)

EMBL: CP000859.PE70

CP000859.PE70        Location/Qualifiers
FT   CDS             78419..80347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0070"
FT                   /product="chaperone protein DnaK"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: sat:SYN_01983 chaperone protein; TIGRFAM:
FT                   chaperone protein DnaK; PFAM: Heat shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65880"
FT                   /db_xref="GOA:A8ZRW3"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZRW3"
FT                   /protein_id="ABW65880.1"
FT                   /translation="MAKTIGIDLGTTNSCVAVMEGGEAKVITNPEGGRTTPSIVAINED
FT                   GERLVGQVAKRQAITNPENTVFGVKRLIGRKFDSAEVQHDIKVLPYKIEKAGNGDLRIN
FT                   LRDKQYSPAEISSFILADIKHTAEEYLGEKVTDAVITVPAYFSDSQRQATKDAGKIAGL
FT                   NVLRIINEPTAASLAYGLDKKKDEKIAVFDLGGGTFDISVLEIGDGVFEVKSTNGDTHL
FT                   GGEDFDLRVVDYLASEFKKDQGIDLRQDKMALQRLKEAAEKAKMELSSSPQTDINLPFI
FT                   TADANGPKHLNIKLSRAKLEELVEDLLDKMAKPCETALKDSGFSASQIDEVILVGGMTR
FT                   MPAVQDRVKKIFGKAPNKSVNPDEVVAIGAAIQAGVLQGDVNDVLLLDVTPLSLGIETL
FT                   GGVMTKLIEKNTTIPTKKSQVFSTAADNQPAVSIHVLQGEREMAANNKTLGRFDLADIP
FT                   AAPRGVPQIEVTFDIDANGIVAVSAKDLGTGKEQSIKITASSGLSKEEIDKLVKDAEAH
FT                   AEEDKNKRELVEAQNTADALIYQTEKSIKELGEDKLDNATKAEIQAKIEELKKAKETTD
FT                   TDQIKKLSDELTQASHKLAEAMYQKASQEGQQASGGDAGASADGGTSSAAGGDDDVIDA
FT                   DYEEAGK"
     MAKTIGIDLG TTNSCVAVME GGEAKVITNP EGGRTTPSIV AINEDGERLV GQVAKRQAIT        60
     NPENTVFGVK RLIGRKFDSA EVQHDIKVLP YKIEKAGNGD LRINLRDKQY SPAEISSFIL       120
     ADIKHTAEEY LGEKVTDAVI TVPAYFSDSQ RQATKDAGKI AGLNVLRIIN EPTAASLAYG       180
     LDKKKDEKIA VFDLGGGTFD ISVLEIGDGV FEVKSTNGDT HLGGEDFDLR VVDYLASEFK       240
     KDQGIDLRQD KMALQRLKEA AEKAKMELSS SPQTDINLPF ITADANGPKH LNIKLSRAKL       300
     EELVEDLLDK MAKPCETALK DSGFSASQID EVILVGGMTR MPAVQDRVKK IFGKAPNKSV       360
     NPDEVVAIGA AIQAGVLQGD VNDVLLLDVT PLSLGIETLG GVMTKLIEKN TTIPTKKSQV       420
     FSTAADNQPA VSIHVLQGER EMAANNKTLG RFDLADIPAA PRGVPQIEVT FDIDANGIVA       480
     VSAKDLGTGK EQSIKITASS GLSKEEIDKL VKDAEAHAEE DKNKRELVEA QNTADALIYQ       540
     TEKSIKELGE DKLDNATKAE IQAKIEELKK AKETTDTDQI KKLSDELTQA SHKLAEAMYQ       600
     KASQEGQQAS GGDAGASADG GTSSAAGGDD DVIDADYEEA GK                          642
//

If you have problems or comments...

PBIL Back to PBIL home page