(data stored in ACNUC7421 zone)

EMBL: CP000859.PE72

CP000859.PE72        Location/Qualifiers
FT   CDS             complement(80934..81455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65882"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRW5"
FT                   /protein_id="ABW65882.1"
FT                   /translation="MFIMFATAVRADKSGAMDKFLTDKDRAVIAQRVLAGTWYPFETYK
FT                   NCFTAVARVVAKDNPETLREWGRQYGEATMTSIYKIILQKKDARSAMTAYNSVFKSQFD
FT                   FGKTEFKMVSDSEILIGLIGFDQNFTILHHVAQGWMERTIQLVINKPVRSEIAGHNWEG
FT                   TPAVVFRLRW"
     MFIMFATAVR ADKSGAMDKF LTDKDRAVIA QRVLAGTWYP FETYKNCFTA VARVVAKDNP        60
     ETLREWGRQY GEATMTSIYK IILQKKDARS AMTAYNSVFK SQFDFGKTEF KMVSDSEILI       120
     GLIGFDQNFT ILHHVAQGWM ERTIQLVINK PVRSEIAGHN WEGTPAVVFR LRW              173
//

If you have problems or comments...

PBIL Back to PBIL home page