(data stored in ACNUC7421 zone)

EMBL: CP000859.PE73

CP000859.PE73        Location/Qualifiers
FT   CDS             complement(81514..82383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0073"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: CoA-binding domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase; KEGG: sfu:Sfum_1702 succinyl-CoA
FT                   synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65883"
FT                   /db_xref="GOA:A8ZRW6"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRW6"
FT                   /protein_id="ABW65883.1"
FT                   /translation="MAIFVDKETRLVVQGITGKEGGFHTRQCVAYGTKVVAGVTPGKGG
FT                   QDVDGIPVFNTVADAVHQTGANCSMIFVPPAFAADAICEAAYAGVDLIVAITEGIPVLD
FT                   MMRVKHILKGRPIRLIGPNCPGIITPGQAKIGIMPGPIHKPGGPIGVVSRSGTLTYEVV
FT                   HQLTGQGIGQTTCVGIGGDPVNGTDFIDCLKAFQNDPDTRGIVMVGEIGGNAEEKAAEF
FT                   IATEVTKPVVGFVAGLTAPPGRRMGHAGAIISGKSGTAEGKLAALEGAGVHLCRNLGTL
FT                   GELCARVF"
     MAIFVDKETR LVVQGITGKE GGFHTRQCVA YGTKVVAGVT PGKGGQDVDG IPVFNTVADA        60
     VHQTGANCSM IFVPPAFAAD AICEAAYAGV DLIVAITEGI PVLDMMRVKH ILKGRPIRLI       120
     GPNCPGIITP GQAKIGIMPG PIHKPGGPIG VVSRSGTLTY EVVHQLTGQG IGQTTCVGIG       180
     GDPVNGTDFI DCLKAFQNDP DTRGIVMVGE IGGNAEEKAA EFIATEVTKP VVGFVAGLTA       240
     PPGRRMGHAG AIISGKSGTA EGKLAALEGA GVHLCRNLGT LGELCARVF                   289
//

If you have problems or comments...

PBIL Back to PBIL home page