(data stored in ACNUC7421 zone)

EMBL: CP000859.PE74

CP000859.PE74        Location/Qualifiers
FT   CDS             complement(82431..83597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0074"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="KEGG: sfu:Sfum_1703 succinyl-CoA synthetase, beta
FT                   subunit; TIGRFAM: succinyl-CoA synthetase, beta subunit;
FT                   PFAM: phosphoribosylglycinamide synthetase; ATP-citrate
FT                   lyase/succinyl-CoA ligase; ATP-grasp domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65884"
FT                   /db_xref="GOA:A8ZRW7"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZRW7"
FT                   /protein_id="ABW65884.1"
FT                   /translation="MKIHEFQTKELFRTYGIPTPEGRMVNTAEAAGEAAGELGGFPVVV
FT                   KAQIHAGGRGKGGGVKLAKSADEAKSLAGAMLGSRLVTPQTGPEGTLVQKVLVEQGVSI
FT                   AKELYLSVVADRETAGIVIMASEAGGMDIEAVAETTPEKILKVFVNPLAGLSAFHCRQA
FT                   AYGLNLPAEAIKPFTQVVSGLFKLFVDYDASLVEINPLILTTDKAVMALDAKINFDDSA
FT                   LFRHKDILALRDTDEEDPLEVEASRFNLNYINMDGNVGNMVNGAGLAMATMDIIKLAGA
FT                   EPANFLDVGGGANAEMVENGFRIILSDPKVKCILVNIFGGILRCDVLASGIVQAARNTA
FT                   IHVPLVVRMEGTNVDEGKRILAESGLDLHSAASLKDAAARVAQVVAAA"
     MKIHEFQTKE LFRTYGIPTP EGRMVNTAEA AGEAAGELGG FPVVVKAQIH AGGRGKGGGV        60
     KLAKSADEAK SLAGAMLGSR LVTPQTGPEG TLVQKVLVEQ GVSIAKELYL SVVADRETAG       120
     IVIMASEAGG MDIEAVAETT PEKILKVFVN PLAGLSAFHC RQAAYGLNLP AEAIKPFTQV       180
     VSGLFKLFVD YDASLVEINP LILTTDKAVM ALDAKINFDD SALFRHKDIL ALRDTDEEDP       240
     LEVEASRFNL NYINMDGNVG NMVNGAGLAM ATMDIIKLAG AEPANFLDVG GGANAEMVEN       300
     GFRIILSDPK VKCILVNIFG GILRCDVLAS GIVQAARNTA IHVPLVVRME GTNVDEGKRI       360
     LAESGLDLHS AASLKDAAAR VAQVVAAA                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page