(data stored in ACNUC7421 zone)

EMBL: CP000859.PE75

CP000859.PE75        Location/Qualifiers
FT   CDS             complement(83597..85642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0075"
FT                   /product="Conserved carboxylase region"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; pyruvate carboxyltransferase; Conserved
FT                   carboxylase region; KEGG: sfu:Sfum_0461 conserved
FT                   carboxylase region"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65885"
FT                   /db_xref="GOA:A8ZRW8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRW8"
FT                   /protein_id="ABW65885.1"
FT                   /translation="MSDHHSVKMTAMNYDKDRPKAENPLKIMDLSLRDGHQSLFATRGR
FT                   TEDMLPVAGLMDEVGFWAVEVWGGATFDTMHRFLNEDPWERIRTLKRYFKKTPLSMLLR
FT                   GQNLVGYRNYADDVARAFVERAAENGMDVFRTFDALNDFRNFETVVEVIKKCGKHFQGT
FT                   ICYSMTEPRLGGEVYNVEYFVTKAKELESMGADTICIKDMAGLVAPYDIFNVVKALKES
FT                   VKPPIHFHSHFTSGLAPMSHLKAVEAGVDILDTCLSPYAYRTSHPAVEPMVMSLLGTNR
FT                   DTGFDINKLVEITEILEEKVMPKYRQFLNEPTMSVIDINVLLHQTPGGMLSNLFGQLKE
FT                   MDALDRLNEVYKELPRVRKDLGQIPLVTPTSQIVGVQTVNNVLFDKDGERYARITDQVK
FT                   DLCYGLYGKTSVPIDSALQKKALAGYPRGETPFTGRPAEILEPELEESKKEIGDLAVDE
FT                   DDLILYALYPVTGKKFLKWKYGQEEPPASVRAKSLEQAKAELALVAKAKAGKVVEKTDK
FT                   HEIPEKSESFRTFHVFVDSEYFEVGVDESGDSPVISYIQQAAARLGSAPAQPMAAAPAA
FT                   PAAPAAQATAAPAAPAPAPEAKTEISVPAAVAPTEGTPLTAPMPGMIVKYLKKVGDTVA
FT                   EGETVVVLEAMKMENALPAPVAGKIASINFDSGDSVPKDAVLCVVS"
     MSDHHSVKMT AMNYDKDRPK AENPLKIMDL SLRDGHQSLF ATRGRTEDML PVAGLMDEVG        60
     FWAVEVWGGA TFDTMHRFLN EDPWERIRTL KRYFKKTPLS MLLRGQNLVG YRNYADDVAR       120
     AFVERAAENG MDVFRTFDAL NDFRNFETVV EVIKKCGKHF QGTICYSMTE PRLGGEVYNV       180
     EYFVTKAKEL ESMGADTICI KDMAGLVAPY DIFNVVKALK ESVKPPIHFH SHFTSGLAPM       240
     SHLKAVEAGV DILDTCLSPY AYRTSHPAVE PMVMSLLGTN RDTGFDINKL VEITEILEEK       300
     VMPKYRQFLN EPTMSVIDIN VLLHQTPGGM LSNLFGQLKE MDALDRLNEV YKELPRVRKD       360
     LGQIPLVTPT SQIVGVQTVN NVLFDKDGER YARITDQVKD LCYGLYGKTS VPIDSALQKK       420
     ALAGYPRGET PFTGRPAEIL EPELEESKKE IGDLAVDEDD LILYALYPVT GKKFLKWKYG       480
     QEEPPASVRA KSLEQAKAEL ALVAKAKAGK VVEKTDKHEI PEKSESFRTF HVFVDSEYFE       540
     VGVDESGDSP VISYIQQAAA RLGSAPAQPM AAAPAAPAAP AAQATAAPAA PAPAPEAKTE       600
     ISVPAAVAPT EGTPLTAPMP GMIVKYLKKV GDTVAEGETV VVLEAMKMEN ALPAPVAGKI       660
     ASINFDSGDS VPKDAVLCVV S                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page