(data stored in ACNUC7421 zone)

EMBL: CP000859.PE79

CP000859.PE79        Location/Qualifiers
FT   CDS             complement(88777..90897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0079"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="KEGG: pla:Plav_1702 methylmalonyl-CoA mutase, large
FT                   subunit; TIGRFAM: methylmalonyl-CoA mutase, large subunit;
FT                   PFAM: methylmalonyl-CoA mutase; cobalamin B12-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65889"
FT                   /db_xref="GOA:A8ZRX2"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRX2"
FT                   /protein_id="ABW65889.1"
FT                   /translation="MANTEKWKQMAEKEMKGKPVDSLLWKTPEGVTIKPLYTKEDAENL
FT                   SHVDTLPGETPFVRGVKATMYAGRPWTIRQYAGFSTAKESNAFYRRNLAAGQKGLSVAF
FT                   DLATHRGYDSDHPRVAGDVGKAGVAIDSIEDMKILFDGIPLDKMSVSMTMNGAVLPVLA
FT                   AYIVAAEEQGVDQKLLAGTIQNDILKEYLTRNTYIYPPTPSMRIVSDIIQYCSTHMPRY
FT                   NTISISGYHMMEAGADSVLQTAFTLADGLEYIKAALAAGLDIDAFAPRLSFFFGIGMNF
FT                   FMEIAMLRAARLLWSEIVGRFSPKDSRSSMLRTHCQTSGWSLTQQDPYNNIIRTTLECL
FT                   SAVLGGTQSLHTNAFDEAVSLPTELSARVARNTQIIVQEESHVCKVVDPLGGSYYVEAL
FT                   TAAIADEARKIIAEIEEMGGMAKAIETGMPKMRIEEAAARRQARIDQGKETVVGVNKYK
FT                   VADESPLEVREVSEAVREEQEARLKELRASRDNEAVKKALEAVTQCAGSGGNLLEACIP
FT                   AIRARATVGEISDAMEKVFGRFVATTQCISGVYAGEYGDSEVIASLRKRTDQFAEKHGR
FT                   KPRILVVKMGQDGHDRGIKVVATGFADLGFDVDIGPMFQTPEEAAKMAVENDVHVVGVS
FT                   SLAAGHKALVPQLIAALKAEGGDDIHVVAGGIIPPADYDVLRSAGVAAVFGPGTVITDS
FT                   ANQVLKVLEAAG"
     MANTEKWKQM AEKEMKGKPV DSLLWKTPEG VTIKPLYTKE DAENLSHVDT LPGETPFVRG        60
     VKATMYAGRP WTIRQYAGFS TAKESNAFYR RNLAAGQKGL SVAFDLATHR GYDSDHPRVA       120
     GDVGKAGVAI DSIEDMKILF DGIPLDKMSV SMTMNGAVLP VLAAYIVAAE EQGVDQKLLA       180
     GTIQNDILKE YLTRNTYIYP PTPSMRIVSD IIQYCSTHMP RYNTISISGY HMMEAGADSV       240
     LQTAFTLADG LEYIKAALAA GLDIDAFAPR LSFFFGIGMN FFMEIAMLRA ARLLWSEIVG       300
     RFSPKDSRSS MLRTHCQTSG WSLTQQDPYN NIIRTTLECL SAVLGGTQSL HTNAFDEAVS       360
     LPTELSARVA RNTQIIVQEE SHVCKVVDPL GGSYYVEALT AAIADEARKI IAEIEEMGGM       420
     AKAIETGMPK MRIEEAAARR QARIDQGKET VVGVNKYKVA DESPLEVREV SEAVREEQEA       480
     RLKELRASRD NEAVKKALEA VTQCAGSGGN LLEACIPAIR ARATVGEISD AMEKVFGRFV       540
     ATTQCISGVY AGEYGDSEVI ASLRKRTDQF AEKHGRKPRI LVVKMGQDGH DRGIKVVATG       600
     FADLGFDVDI GPMFQTPEEA AKMAVENDVH VVGVSSLAAG HKALVPQLIA ALKAEGGDDI       660
     HVVAGGIIPP ADYDVLRSAG VAAVFGPGTV ITDSANQVLK VLEAAG                      706
//

If you have problems or comments...

PBIL Back to PBIL home page