(data stored in ACNUC7421 zone)

EMBL: CP000859.PE80

CP000859.PE80        Location/Qualifiers
FT   CDS             complement(90941..91348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0080"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: sfu:Sfum_0455
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65890"
FT                   /db_xref="GOA:A8ZRX3"
FT                   /db_xref="InterPro:IPR017515"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRX3"
FT                   /protein_id="ABW65890.1"
FT                   /translation="MKILKIDHLGIAVNNIEEGKKFWCDMLGLPFEGTETVEAQKVTTA
FT                   FLPVGESEAELLEATGPESPVAKYIEKKGQGVHHIAFRVENIEAALAELKEKGVALIDE
FT                   IPRKGAGGGKIAFIHPKATGGVLVELCERSG"
     MKILKIDHLG IAVNNIEEGK KFWCDMLGLP FEGTETVEAQ KVTTAFLPVG ESEAELLEAT        60
     GPESPVAKYI EKKGQGVHHI AFRVENIEAA LAELKEKGVA LIDEIPRKGA GGGKIAFIHP       120
     KATGGVLVEL CERSG                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page