(data stored in ACNUC7421 zone)

EMBL: CP000859.PE85

CP000859.PE85        Location/Qualifiers
FT   CDS             95607..95825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0085"
FT                   /product="nitrogen-fixing NifU domain protein"
FT                   /note="PFAM: nitrogen-fixing NifU domain protein; KEGG:
FT                   pca:Pcar_2331 thioredoxin-like proteins and domains-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65895"
FT                   /db_xref="GOA:A8ZRX8"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRX8"
FT                   /protein_id="ABW65895.1"
FT                   /translation="MKEQVKAALDKIRPQLQADGGDVELVDVENGNVSVRLKGACAGCP
FT                   MSQITLKQRIEAYLKKTVPGVINVEKV"
     MKEQVKAALD KIRPQLQADG GDVELVDVEN GNVSVRLKGA CAGCPMSQIT LKQRIEAYLK        60
     KTVPGVINVE KV                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page