(data stored in ACNUC7421 zone)

EMBL: CP000859.PE91

CP000859.PE91        Location/Qualifiers
FT   CDS             100059..100727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0091"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="3.5.4.4"
FT                   /note="KEGG: sat:SYN_02003 nicotinate-nucleotide
FT                   adenylyltransferase; TIGRFAM: cytidyltransferase-related
FT                   domain; nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase; PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65901"
FT                   /db_xref="GOA:A8ZRY4"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRY4"
FT                   /protein_id="ABW65901.1"
FT                   /translation="MPTAGIIKKGLFGGTFNPVHTGHVCLTNALLKDFPLDRVIVVPTA
FT                   RPPHKPVDYIADPADRFHMVGLAFENMAGVSVSDAEMVQTGPCYTIDTVRYFISSDPQS
FT                   SFYLILGLDAFLELDTWKSYMSLVASLPLIVFSRTLDHASEKTAFENFLTSTLSKAYVF
FT                   SEKQAGYVHPTLYPVFFYAARHFDISATGIRARIKAGLPIKGLVPDPVAQYIRKKGLYI
FT                   "
     MPTAGIIKKG LFGGTFNPVH TGHVCLTNAL LKDFPLDRVI VVPTARPPHK PVDYIADPAD        60
     RFHMVGLAFE NMAGVSVSDA EMVQTGPCYT IDTVRYFISS DPQSSFYLIL GLDAFLELDT       120
     WKSYMSLVAS LPLIVFSRTL DHASEKTAFE NFLTSTLSKA YVFSEKQAGY VHPTLYPVFF       180
     YAARHFDISA TGIRARIKAG LPIKGLVPDP VAQYIRKKGL YI                          222
//

If you have problems or comments...

PBIL Back to PBIL home page