(data stored in ACNUC7421 zone)

EMBL: CP000859.PE92

CP000859.PE92        Location/Qualifiers
FT   CDS             100724..101068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0092"
FT                   /product="iojap-like protein"
FT                   /note="TIGRFAM: iojap-like protein; PFAM: Iojap-related
FT                   protein; KEGG: sfu:Sfum_3646 iojap-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65902"
FT                   /db_xref="GOA:A8ZRY5"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRY5"
FT                   /protein_id="ABW65902.1"
FT                   /translation="MTASSKTEIEPYLTAINGMKAENVVALDVSRLTSIADVFILCEGR
FT                   SNRQVSAISDHIVKALKDQGIKPLSMEGVSEGRWVLLDYGDVIIHVFYESVRAFYDIEG
FT                   LWADARRIEV"
     MTASSKTEIE PYLTAINGMK AENVVALDVS RLTSIADVFI LCEGRSNRQV SAISDHIVKA        60
     LKDQGIKPLS MEGVSEGRWV LLDYGDVIIH VFYESVRAFY DIEGLWADAR RIEV             114
//

If you have problems or comments...

PBIL Back to PBIL home page