(data stored in ACNUC7421 zone)

EMBL: CP000859.PE93

CP000859.PE93        Location/Qualifiers
FT   CDS             101094..102629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0093"
FT                   /product="phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /EC_number="5.4.2.-"
FT                   /note="KEGG: pca:Pcar_2574 phosphoglyceromutase; TIGRFAM:
FT                   phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: metalloenzyme
FT                   domain protein; BPG-independent PGAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65903"
FT                   /db_xref="GOA:A8ZRY6"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRY6"
FT                   /protein_id="ABW65903.1"
FT                   /translation="MTKATPPCMLMILDGWGLNPETKGNAVAAARTPHLDRLFSEYPHT
FT                   RLVCSGEAVGLPPGYMGNSEVGHLNIGAGRVVYQELMRINVAIQDGSFFKNTVIVQLMD
FT                   QVTKKQGRLHLIGLLSDGGVHSHLDHLKALVRMASNKNLPVLIHTILDGRDTPPDSGKT
FT                   YMADLCEFLADYPSASVATVCGRFYAMDRDTRWDRTKKAYDLYTLGEGTRESDPVTAVK
FT                   NAYLRGETDEFVTPVIIASGSQDGGTVADNDGILFFNFRADRMREIVRAFTDPDFSFFN
FT                   RKKTPAVAPPVCMTLYDKTFPLPVAFPPENPPNTLGEVISRQGYSQLRIAETEKYAHVT
FT                   YFFNGGVETPFTGEDRKLIPSPREVATYDMKPEMSAPQVANTLAEEIIKQKYDFIVVNF
FT                   ANMDMVGHTGIFAAAVAACETVDACIGKIIPLFLKSGGVVLVTADHGNSEQMEDQNGHP
FT                   FTAHTTNPVPLILVDENRKQIILKEGKLADIGPTILFIMKIDQPAEMTGNSLL"
     MTKATPPCML MILDGWGLNP ETKGNAVAAA RTPHLDRLFS EYPHTRLVCS GEAVGLPPGY        60
     MGNSEVGHLN IGAGRVVYQE LMRINVAIQD GSFFKNTVIV QLMDQVTKKQ GRLHLIGLLS       120
     DGGVHSHLDH LKALVRMASN KNLPVLIHTI LDGRDTPPDS GKTYMADLCE FLADYPSASV       180
     ATVCGRFYAM DRDTRWDRTK KAYDLYTLGE GTRESDPVTA VKNAYLRGET DEFVTPVIIA       240
     SGSQDGGTVA DNDGILFFNF RADRMREIVR AFTDPDFSFF NRKKTPAVAP PVCMTLYDKT       300
     FPLPVAFPPE NPPNTLGEVI SRQGYSQLRI AETEKYAHVT YFFNGGVETP FTGEDRKLIP       360
     SPREVATYDM KPEMSAPQVA NTLAEEIIKQ KYDFIVVNFA NMDMVGHTGI FAAAVAACET       420
     VDACIGKIIP LFLKSGGVVL VTADHGNSEQ MEDQNGHPFT AHTTNPVPLI LVDENRKQII       480
     LKEGKLADIG PTILFIMKID QPAEMTGNSL L                                      511
//

If you have problems or comments...

PBIL Back to PBIL home page