(data stored in ACNUC7421 zone)

EMBL: CP000859.PE94

CP000859.PE94        Location/Qualifiers
FT   CDS             103072..104205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0094"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: ppd:Ppro_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65904"
FT                   /db_xref="GOA:A8ZRY7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRY7"
FT                   /protein_id="ABW65904.1"
FT                   /translation="MKLSVEKKDIIEMLANVQGIAGKRSSLAITENILIKTGKEGISVS
FT                   ATDIETGFEGIYPATIENEGTIAINARQFYEIVKKIDSNIIYLREEKKQWIQISDTEDG
FT                   SRLKYQIMGGETESFPQLPVIADVSYIDVNSADFKNMILWATVITSSGTEKRAHVIGAN
FT                   LEYIKDGKIKKIRMVSTDGKRLTKTEYSYKKGEPDTPETSTILPKKALNELFKFLKDEG
FT                   TIQIGTRDNYFIVKNNNEIIYINLLSGEYPNLETLFSDEKGRTEIKINRKKLKDMLERM
FT                   SILTTDNYKGVIFTFEKNILTINAQNPDRGESYEWMDIQYDKKQIKSMFNPDYFIDAVN
FT                   LIEDDEVCLKLKEDQAPCIVCGGKHPENINIIMPMKI"
     MKLSVEKKDI IEMLANVQGI AGKRSSLAIT ENILIKTGKE GISVSATDIE TGFEGIYPAT        60
     IENEGTIAIN ARQFYEIVKK IDSNIIYLRE EKKQWIQISD TEDGSRLKYQ IMGGETESFP       120
     QLPVIADVSY IDVNSADFKN MILWATVITS SGTEKRAHVI GANLEYIKDG KIKKIRMVST       180
     DGKRLTKTEY SYKKGEPDTP ETSTILPKKA LNELFKFLKD EGTIQIGTRD NYFIVKNNNE       240
     IIYINLLSGE YPNLETLFSD EKGRTEIKIN RKKLKDMLER MSILTTDNYK GVIFTFEKNI       300
     LTINAQNPDR GESYEWMDIQ YDKKQIKSMF NPDYFIDAVN LIEDDEVCLK LKEDQAPCIV       360
     CGGKHPENIN IIMPMKI                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page