(data stored in ACNUC7421 zone)

EMBL: CP000859.PE98

CP000859.PE98        Location/Qualifiers
FT   CDS             110589..112142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0098"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; PFAM: RNA
FT                   binding S1 domain protein; KEGG: sfu:Sfum_1609
FT                   ribonuclease, Rne/Rng family"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65908"
FT                   /db_xref="GOA:A8ZRZ1"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRZ1"
FT                   /protein_id="ABW65908.1"
FT                   /translation="MLLHMSKELIINATENETRVALLEDGILAEFFMERGNHLNISGNI
FT                   YKARVNRVLPGMQAAFVDIGLDQAAFIYVTDVFSEPSREVENIFNETAEEPEPVAVARE
FT                   DEFDLSVPVPPADVKIEDLLSEGQEILVQVSKSPIGSKGARITTRISLPGRFLVLMPTV
FT                   DHVGVSKRIVEDGERQRLKELVVSLRTEPFGFIVRTAAEGVEKEKLEKEMILLVNLWQK
FT                   VQKRFASASAPALLHRDMTVSLRAVRDYLTHEADRVVVDADYVYDEIMTFLDEIMPRMK
FT                   ASVERYTGSEPIFDAYNIEGDVFRSLKKKVWLKSGGYIIIEPTEALVVIDVNTGGYVGK
FT                   HNFEETVFKTNLEAAREIAYQIRLRNLGGIIIIDFIDMAREANREKVFVSLKEFLEKDK
FT                   SKTTLLPFSELGLIQMTRKRTRNSVARMLCEPCFYCNGDGYLLSRQTICFNIYREIMRE
FT                   SQDLSGEKITVKVHPDIAEMLHGEESRVVTGLEADLGRQIIIYPVPKFHIEQFEIEEIL
FT                   "
     MLLHMSKELI INATENETRV ALLEDGILAE FFMERGNHLN ISGNIYKARV NRVLPGMQAA        60
     FVDIGLDQAA FIYVTDVFSE PSREVENIFN ETAEEPEPVA VAREDEFDLS VPVPPADVKI       120
     EDLLSEGQEI LVQVSKSPIG SKGARITTRI SLPGRFLVLM PTVDHVGVSK RIVEDGERQR       180
     LKELVVSLRT EPFGFIVRTA AEGVEKEKLE KEMILLVNLW QKVQKRFASA SAPALLHRDM       240
     TVSLRAVRDY LTHEADRVVV DADYVYDEIM TFLDEIMPRM KASVERYTGS EPIFDAYNIE       300
     GDVFRSLKKK VWLKSGGYII IEPTEALVVI DVNTGGYVGK HNFEETVFKT NLEAAREIAY       360
     QIRLRNLGGI IIIDFIDMAR EANREKVFVS LKEFLEKDKS KTTLLPFSEL GLIQMTRKRT       420
     RNSVARMLCE PCFYCNGDGY LLSRQTICFN IYREIMRESQ DLSGEKITVK VHPDIAEMLH       480
     GEESRVVTGL EADLGRQIII YPVPKFHIEQ FEIEEIL                                517
//

If you have problems or comments...

PBIL Back to PBIL home page