(data stored in ACNUC7421 zone)

EMBL: CP000859.PE99

CP000859.PE99        Location/Qualifiers
FT   CDS             112349..112483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0099"
FT                   /product="ribosomal protein L34"
FT                   /note="PFAM: ribosomal protein L34; KEGG: pmy:Pmen_4623
FT                   ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65909"
FT                   /db_xref="GOA:A8ZRZ2"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ZRZ2"
FT                   /protein_id="ABW65909.1"
FT                   /translation="MKRTYQPSNVKRARKHGFRARMATKQGRSILKRRRAKGRKRLTV"
     MKRTYQPSNV KRARKHGFRA RMATKQGRSI LKRRRAKGRK RLTV                         44
//

If you have problems or comments...

PBIL Back to PBIL home page