(data stored in SCRATCH zone)

EMBL: CP000880.PE100

CP000880.PE100       Location/Qualifiers
FT   CDS             98438..98743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00101"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG19625 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00101"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20054"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFA2"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457266.1"
FT                   /protein_id="ABX20054.1"
FT                   /translation="MPIATIVPTNAVIGQAVNIRPMETDIVSLDDRLLQAFSGSAIATA
FT                   VDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS"
     MPIATIVPTN AVIGQAVNIR PMETDIVSLD DRLLQAFSGS AIATAVDKQT ITNRIEDPNL        60
     VTDPKELAIS QEMISDYNLY VSMVSTLTRK GVGAVETLLR S                           101
//

If you have problems or comments...

PBIL Back to PBIL home page