(data stored in SCRATCH zone)

EMBL: CP000880.PE120

CP000880.PE120       Location/Qualifiers
FT   CDS             115248..117074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00121"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C3086 2.2e-287 hycC; formate
FT                   hydrogenlyase subunit 3; COG: COG0651 Formate hydrogenlyase
FT                   subunit 3/Multisubunit Na+/H+ antiporter, MnhD subunit;
FT                   Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00121"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20074"
FT                   /db_xref="GOA:A9MFW6"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFW6"
FT                   /inference="protein motif:HMMPfam:IPR001750"
FT                   /protein_id="ABX20074.1"
FT                   /translation="MSSLSLITSGVVWFVAAAVLAFLFSFHKALSGWVAGIGGAVGSLC
FT                   TAGAGFTALTSAVTVSGVMPFTGQMLQITPLNAIWLITLGLCGLFVSLFNIDWHRHPQV
FT                   KANGLLVNLLIAAAVCAVVASNLGTMVVMAEIMALCAVFLTGGSKEGKLWFALGRLGTL
FT                   LLAIACGLAWQRYGTLDMGLLDQRAQQLPLGSDIWLLGVIGFGLLAGIIPLHGWVPQAH
FT                   ANASAPAAALFSTVVMKIGLLGILSLSLIGGNAPLWWGVALLVLGIITAFVGGLYALME
FT                   HNIQRLLAYHTLENIGIILLGLGAGVTGIALNQPALIALGLTGGLYHLVNHSLFKSVLF
FT                   LGAGSIWFCTGHRDIEKLGGIGKRMPVISIAMLVGLMAMAALPPLNGFAGEWVIYQSFF
FT                   RLGNSGAFVGRLLGPLLAVGLAVTGALAVMCMAKVYGVTFLGAPRTKEAENASCAPILM
FT                   GVSVVALAICCVLGGVAAPWLLPMISTAVPLPLETAHTTVSQPMITLLLIACPLLPFII
FT                   MAMFKGNRLPSRSRGAAWVCGYDHERSMVITAHGFAMPVKEAFAPVLKLRQWLNPVSLV
FT                   PGWQSAAAAVLFRRLALIELAVLVVIVVSRGA"
     MSSLSLITSG VVWFVAAAVL AFLFSFHKAL SGWVAGIGGA VGSLCTAGAG FTALTSAVTV        60
     SGVMPFTGQM LQITPLNAIW LITLGLCGLF VSLFNIDWHR HPQVKANGLL VNLLIAAAVC       120
     AVVASNLGTM VVMAEIMALC AVFLTGGSKE GKLWFALGRL GTLLLAIACG LAWQRYGTLD       180
     MGLLDQRAQQ LPLGSDIWLL GVIGFGLLAG IIPLHGWVPQ AHANASAPAA ALFSTVVMKI       240
     GLLGILSLSL IGGNAPLWWG VALLVLGIIT AFVGGLYALM EHNIQRLLAY HTLENIGIIL       300
     LGLGAGVTGI ALNQPALIAL GLTGGLYHLV NHSLFKSVLF LGAGSIWFCT GHRDIEKLGG       360
     IGKRMPVISI AMLVGLMAMA ALPPLNGFAG EWVIYQSFFR LGNSGAFVGR LLGPLLAVGL       420
     AVTGALAVMC MAKVYGVTFL GAPRTKEAEN ASCAPILMGV SVVALAICCV LGGVAAPWLL       480
     PMISTAVPLP LETAHTTVSQ PMITLLLIAC PLLPFIIMAM FKGNRLPSRS RGAAWVCGYD       540
     HERSMVITAH GFAMPVKEAF APVLKLRQWL NPVSLVPGWQ SAAAAVLFRR LALIELAVLV       600
     VIVVSRGA                                                                608
//

If you have problems or comments...

PBIL Back to PBIL home page