(data stored in SCRATCH zone)

EMBL: CP000880.PE125

CP000880.PE125       Location/Qualifiers
FT   CDS             121043..121453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00126"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C3081 2.2e-63 hycH; formate
FT                   hydrogenlyase maturation protein HycH; COG: NOG09848 non
FT                   supervised orthologous group; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00126"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20079"
FT                   /db_xref="InterPro:IPR010005"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFX1"
FT                   /inference="protein motif:HMMPfam:IPR010005"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457240.1"
FT                   /protein_id="ABX20079.1"
FT                   /translation="MSEQVVFSQLSRKFIDENDATPAEAQQVVYYSLAIGHHLGVIDCL
FT                   EAALTCPWDEYLAWIATLEAGSDARRKMEGVPKYGEIVIDFNHVSMLARAFDNARAAQT
FT                   PQQQEWSKLMLSMLHDIHQESAIYLMVRRLRD"
     MSEQVVFSQL SRKFIDENDA TPAEAQQVVY YSLAIGHHLG VIDCLEAALT CPWDEYLAWI        60
     ATLEAGSDAR RKMEGVPKYG EIVIDFNHVS MLARAFDNAR AAQTPQQQEW SKLMLSMLHD       120
     IHQESAIYLM VRRLRD                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page