(data stored in SCRATCH zone)

EMBL: CP000880.PE128

CP000880.PE128       Location/Qualifiers
FT   CDS             122788..125028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: msu:MS0845 3.5e-06 acyP; acylphosphatases
FT                   K01512; COG: COG0068 Hydrogenase maturation factor"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00129"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20082"
FT                   /db_xref="GOA:A9MFX4"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFX4"
FT                   /inference="protein motif:BlastProDom:IPR001792"
FT                   /inference="protein motif:BlastProDom:IPR006071"
FT                   /inference="protein motif:HMMPfam:IPR001792"
FT                   /inference="protein motif:HMMPfam:IPR006070"
FT                   /inference="protein motif:HMMPfam:IPR011125"
FT                   /inference="protein motif:HMMPIR:IPR004421"
FT                   /inference="protein motif:HMMTigr:IPR004421"
FT                   /inference="protein motif:ScanRegExp:IPR001792"
FT                   /inference="protein motif:superfamily:IPR011056"
FT                   /protein_id="ABX20082.1"
FT                   /translation="MAIDTPSGVQLRIRGKVQGVGFRPFVWQLAQQLRLHGDVCNDGDG
FT                   VVVRLLEEPSQFIAALYQHCPPLARIDSVEHESLIWERTPTDFAIRQSAGGAMNTQIVP
FT                   DAATCPACLAEMNTPGERRYRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPECD
FT                   TEYRDPYDRRFHAQPVACPACGPHLEWLSQCERAEKEAALQAAVAQLNAGGIIAVKGLG
FT                   GFHLVCDARNNSAVAMLRARKHRPAKPLAVMLPTAQTLPTAARSLLTTPAAPIVLVDKQ
FT                   SVPSLCEGIAPGLTEVGVMLPANPLQHLLLQALNYPLVMTSGNLSGRPPAITNEQALDD
FT                   LHDIADGFLLHNRDIVQRMDDSVVRDSGEMLRRSRGYVPDAIALPPGFRDVPPILCLGA
FT                   DLKNTFCLVRGEQAVVSQHLGDLSDDGIQAQWREALRLIQSIYDFTPERIVCDAHPGYV
FT                   SSRWASEMRLPTGAVLHHHAHAAACLAEHGWPLDGGEVIALTVDGIGMGENGALWGGEC
FT                   LRVNYRQCERLGGLPAVALPGGDLAARQPWRNLLAQCLRFVPDWQNYPETAGVQQQSWN
FT                   VLARAIERGVNAPLASSCGRLFDAVAAALRCAPALLSYEGEAACALEALASQCVHVKHP
FT                   VTMPLNGAQLDLAVFWRQWLSWQATPAQRAWAFHDALACGFATLMRQQATARGITTLVF
FT                   SGGVIHNRLLRARLSFYLSDFNLLFPQQFPAGDGGLSLGQGVVAAARWLSEA"
     MAIDTPSGVQ LRIRGKVQGV GFRPFVWQLA QQLRLHGDVC NDGDGVVVRL LEEPSQFIAA        60
     LYQHCPPLAR IDSVEHESLI WERTPTDFAI RQSAGGAMNT QIVPDAATCP ACLAEMNTPG       120
     ERRYRYPFIN CTHCGPRFTI IRAMPYDRPF TVMAAFPLCP ECDTEYRDPY DRRFHAQPVA       180
     CPACGPHLEW LSQCERAEKE AALQAAVAQL NAGGIIAVKG LGGFHLVCDA RNNSAVAMLR       240
     ARKHRPAKPL AVMLPTAQTL PTAARSLLTT PAAPIVLVDK QSVPSLCEGI APGLTEVGVM       300
     LPANPLQHLL LQALNYPLVM TSGNLSGRPP AITNEQALDD LHDIADGFLL HNRDIVQRMD       360
     DSVVRDSGEM LRRSRGYVPD AIALPPGFRD VPPILCLGAD LKNTFCLVRG EQAVVSQHLG       420
     DLSDDGIQAQ WREALRLIQS IYDFTPERIV CDAHPGYVSS RWASEMRLPT GAVLHHHAHA       480
     AACLAEHGWP LDGGEVIALT VDGIGMGENG ALWGGECLRV NYRQCERLGG LPAVALPGGD       540
     LAARQPWRNL LAQCLRFVPD WQNYPETAGV QQQSWNVLAR AIERGVNAPL ASSCGRLFDA       600
     VAAALRCAPA LLSYEGEAAC ALEALASQCV HVKHPVTMPL NGAQLDLAVF WRQWLSWQAT       660
     PAQRAWAFHD ALACGFATLM RQQATARGIT TLVFSGGVIH NRLLRARLSF YLSDFNLLFP       720
     QQFPAGDGGL SLGQGVVAAA RWLSEA                                            746
//

If you have problems or comments...

PBIL Back to PBIL home page