(data stored in SCRATCH zone)

EMBL: CP000880.PE131

CP000880.PE131       Location/Qualifiers
FT   CDS             127850..129400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00132"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_B2325 3.6e-111 norR2; nitric oxide
FT                   reductase regulator (NorR2) K01529; COG: COG3604
FT                   Transcriptional regulator containing GAF, AAA-type ATPase,
FT                   and DNA binding domains; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00132"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20085"
FT                   /db_xref="GOA:A9MFX7"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023944"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MFX7"
FT                   /inference="protein motif:HMMPfam:IPR002078"
FT                   /inference="protein motif:HMMPfam:IPR003018"
FT                   /inference="protein motif:HMMSmart:IPR003018"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:ScanRegExp:IPR002078"
FT                   /inference="protein motif:superfamily:IPR008931"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461760.1"
FT                   /func_characterised="similar sequence"
FT                   /protein_id="ABX20085.1"
FT                   /translation="MHCQNDNEVAMSFSVEVLAGIAIELQRGIGHQDRFQRLITTLRQV
FT                   LACDASALLRYESGQFIPLAIDGLAQDVLGRRFTLEGHPRLEAIARAGDVVRFPADSDL
FT                   PDPYDGLIPGQESLKVHACVGLPLFAGQNLIGALTFDAMTPAQFEVFSDEELRLIAALA
FT                   AGALSNALLIEQLESQNMLPRSSAAFEPIKETHMIGLSPAMTQLKKEIEIVASSDLNVL
FT                   IGGETGTGKELVAKAIHQGSPRAVNPLVYLNCAALPESVAESELFGHVKGAFTGAISNR
FT                   SGKFEMADNGTLFLDEIGELSLALQAKLLRVLQYGDIQRVGDDRSLRVDVRVLAATNRD
FT                   LREEVLAGRFRADLFHRLSVFPLFVPPLRERGNDVVLLAGYFCEQCRLRLGLSRVVLSP
FT                   GARRHLLNYGWPGNVRELEHAIHRAVVLARATRAGDEVILEAQHFALSEDVLPAPPAES
FT                   FLALPNCRNLRESTENFQRELIRQALAQNHHNWAASARALETDVANLHRLAKRLGLKD"
     MHCQNDNEVA MSFSVEVLAG IAIELQRGIG HQDRFQRLIT TLRQVLACDA SALLRYESGQ        60
     FIPLAIDGLA QDVLGRRFTL EGHPRLEAIA RAGDVVRFPA DSDLPDPYDG LIPGQESLKV       120
     HACVGLPLFA GQNLIGALTF DAMTPAQFEV FSDEELRLIA ALAAGALSNA LLIEQLESQN       180
     MLPRSSAAFE PIKETHMIGL SPAMTQLKKE IEIVASSDLN VLIGGETGTG KELVAKAIHQ       240
     GSPRAVNPLV YLNCAALPES VAESELFGHV KGAFTGAISN RSGKFEMADN GTLFLDEIGE       300
     LSLALQAKLL RVLQYGDIQR VGDDRSLRVD VRVLAATNRD LREEVLAGRF RADLFHRLSV       360
     FPLFVPPLRE RGNDVVLLAG YFCEQCRLRL GLSRVVLSPG ARRHLLNYGW PGNVRELEHA       420
     IHRAVVLARA TRAGDEVILE AQHFALSEDV LPAPPAESFL ALPNCRNLRE STENFQRELI       480
     RQALAQNHHN WAASARALET DVANLHRLAK RLGLKD                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page