(data stored in SCRATCH zone)

EMBL: CP000880.PE132

CP000880.PE132       Location/Qualifiers
FT   CDS             complement(129397..130362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00133"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C3070 1.9e-153 gutQ; GutQ protein
FT                   K02467; COG: COG0794 Predicted sugar phosphate isomerase
FT                   involved in capsule formation; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00133"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20086"
FT                   /db_xref="GOA:A9MFX8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFX8"
FT                   /inference="protein motif:HMMPfam:IPR000644"
FT                   /inference="protein motif:HMMPfam:IPR001347"
FT                   /inference="protein motif:HMMTigr:IPR004800"
FT                   /inference="similar to AA sequence:INSD:AAO70301.1"
FT                   /protein_id="ABX20086.1"
FT                   /translation="MSDALLHAGRQTLMLELQEASRLPERLGDDFVRAANIIIHCEGKV
FT                   IVSGIGKSGHIGKKIAATLASTGTPAFFVHPAEALHGDLGMIESRDVMLFISYSGGAKE
FT                   LDLIIPRLEDKSVALLAMTGKPHSPLGRAAKAVLDISVEREACPMHLAPTSSTVNTLMM
FT                   GDALAMAVMQARGFNEEDFARSHPAGALGARLLNNVHHLMRQGDAIPQVMLATSVMDAM
FT                   LELSRTGLGLVAVCDEQHVVKGVFTDGDLRRWLVSGGALTTPVSEAMTPNGITLQAQSR
FT                   AIDAKELLMKRKITAAPVVDENGKLTGAINLQDFYQAGII"
     MSDALLHAGR QTLMLELQEA SRLPERLGDD FVRAANIIIH CEGKVIVSGI GKSGHIGKKI        60
     AATLASTGTP AFFVHPAEAL HGDLGMIESR DVMLFISYSG GAKELDLIIP RLEDKSVALL       120
     AMTGKPHSPL GRAAKAVLDI SVEREACPMH LAPTSSTVNT LMMGDALAMA VMQARGFNEE       180
     DFARSHPAGA LGARLLNNVH HLMRQGDAIP QVMLATSVMD AMLELSRTGL GLVAVCDEQH       240
     VVKGVFTDGD LRRWLVSGGA LTTPVSEAMT PNGITLQAQS RAIDAKELLM KRKITAAPVV       300
     DENGKLTGAI NLQDFYQAGI I                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page