(data stored in SCRATCH zone)

EMBL: CP000880.PE137

CP000880.PE137       Location/Qualifiers
FT   CDS             complement(132428..132790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00138"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA2692 2.5e-57 srlB;
FT                   glucitol/sorbitol-specific IIA component of PTS system
FT                   K02781; COG: COG3731 Phosphotransferase system
FT                   sorbitol-specific component IIA"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00138"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20091"
FT                   /db_xref="GOA:A9MFY3"
FT                   /db_xref="InterPro:IPR004716"
FT                   /db_xref="InterPro:IPR036665"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFY3"
FT                   /inference="protein motif:BlastProDom:IPR004716"
FT                   /inference="protein motif:HMMPfam:IPR004716"
FT                   /inference="protein motif:HMMPIR:IPR004716"
FT                   /inference="similar to AA sequence:INSD:AAV78549.1"
FT                   /protein_id="ABX20091.1"
FT                   /translation="MSVIYQTTITRIGQSAAEALGEQMLITFREGAPADIEEFCFIHCH
FT                   GELTGELQPGARFELGQHCYPVTAVGSVAGQNLRELGHITLRFDGLREAEFPGTVHVAG
FT                   LVPDDIAPGCILKFIA"
     MSVIYQTTIT RIGQSAAEAL GEQMLITFRE GAPADIEEFC FIHCHGELTG ELQPGARFEL        60
     GQHCYPVTAV GSVAGQNLRE LGHITLRFDG LREAEFPGTV HVAGLVPDDI APGCILKFIA       120
//

If you have problems or comments...

PBIL Back to PBIL home page