(data stored in SCRATCH zone)

EMBL: CP000880.PE145

CP000880.PE145       Location/Qualifiers
FT   CDS             138636..140990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00146"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2827 0. alaS; alanyl-tRNA synthetase
FT                   K01872; COG: COG0013 Alanyl-tRNA synthetase; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00146"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20099"
FT                   /db_xref="GOA:A9MFZ1"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MFZ1"
FT                   /inference="protein motif:FPrintScan:IPR002318"
FT                   /inference="protein motif:HMMPfam:IPR002318"
FT                   /inference="protein motif:HMMPfam:IPR003156"
FT                   /inference="protein motif:HMMPfam:IPR012947"
FT                   /inference="protein motif:HMMTigr:IPR002318"
FT                   /func_characterised="similar sequence"
FT                   /protein_id="ABX20099.1"
FT                   /translation="MLGNFSFGDYFKHDAIQFAWELLTGENWFALPKERLWVTVYETDD
FT                   EAYGIWEKEVGIPRERIIRIGDNKGAPYASDNFWQMGDTGPCGPCTEIFYDHGDHIWGG
FT                   PPGSPEEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLERIAAVLQHVNSNY
FT                   EIDLFRTLIEAVAKVTGATDLSNKSLRVIADHIRSCAFLVADGVLPSNENRGYVLRRII
FT                   RRAVRHGNMLGAKETFFYKLVGPLIEVMGSAGEELKRQQAQVEQVLKTEEEQFARTLER
FT                   GLALLDEELAKLQGDTLDGETAFRLYDTYGFPVDLTADVCRERDIKVDEAGFETAMEEQ
FT                   RRRAREASGFGADYNAMIRVDSASEFKGYDHLELNGKVTALFVNGKAVEAINAGQEAVV
FT                   VLDQTPFYAESGGQVGDKGELKGVGFTFAVNDTQKYGQAIGHLGKLSAGALKVGDVVQA
FT                   DVDEARRARIRLNHSATHLMHAALRQVLGAHVAQKGSLVSDKVLRFDFSHNEAMKPSEI
FT                   REVEDLVNAQIRRNLPIETHIMELEAAKAKGAMALFGEKYDERVRVLSMGDFSTELCGG
FT                   THARRTGDIGLFRIISESGTAAGVRRIEAVTGEGAMATVHAQSDRLNDIAHLLKGDSQN
FT                   LGDKVRAVLERSRQLEKELQQLKDQAAAQESASLSSKAVDLNGVKLLVSELAGVEPKML
FT                   RTMVDDLKNQLGSTVIVLATVVEGKVSLIAGVSKDVTGRVKAGELIGMVAQQVGGKGGG
FT                   RPDMAQAGGTDAAALPAALASVQDWVSAKLQ"
     MLGNFSFGDY FKHDAIQFAW ELLTGENWFA LPKERLWVTV YETDDEAYGI WEKEVGIPRE        60
     RIIRIGDNKG APYASDNFWQ MGDTGPCGPC TEIFYDHGDH IWGGPPGSPE EDGDRYIEIW       120
     NIVFMQFNRQ ADGTMEPLPK PSVDTGMGLE RIAAVLQHVN SNYEIDLFRT LIEAVAKVTG       180
     ATDLSNKSLR VIADHIRSCA FLVADGVLPS NENRGYVLRR IIRRAVRHGN MLGAKETFFY       240
     KLVGPLIEVM GSAGEELKRQ QAQVEQVLKT EEEQFARTLE RGLALLDEEL AKLQGDTLDG       300
     ETAFRLYDTY GFPVDLTADV CRERDIKVDE AGFETAMEEQ RRRAREASGF GADYNAMIRV       360
     DSASEFKGYD HLELNGKVTA LFVNGKAVEA INAGQEAVVV LDQTPFYAES GGQVGDKGEL       420
     KGVGFTFAVN DTQKYGQAIG HLGKLSAGAL KVGDVVQADV DEARRARIRL NHSATHLMHA       480
     ALRQVLGAHV AQKGSLVSDK VLRFDFSHNE AMKPSEIREV EDLVNAQIRR NLPIETHIME       540
     LEAAKAKGAM ALFGEKYDER VRVLSMGDFS TELCGGTHAR RTGDIGLFRI ISESGTAAGV       600
     RRIEAVTGEG AMATVHAQSD RLNDIAHLLK GDSQNLGDKV RAVLERSRQL EKELQQLKDQ       660
     AAAQESASLS SKAVDLNGVK LLVSELAGVE PKMLRTMVDD LKNQLGSTVI VLATVVEGKV       720
     SLIAGVSKDV TGRVKAGELI GMVAQQVGGK GGGRPDMAQA GGTDAAALPA ALASVQDWVS       780
     AKLQ                                                                    784
//

If you have problems or comments...

PBIL Back to PBIL home page