(data stored in SCRATCH zone)

EMBL: CP000880.PE151

CP000880.PE151       Location/Qualifiers
FT   CDS             complement(145977..147515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00158"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgl:SG1466 5.5e-07 dethiobiotin synthase
FT                   K01935; COG: COG0477 Permeases of the major facilitator
FT                   superfamily; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00158"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20105"
FT                   /db_xref="GOA:A9MFZ7"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFZ7"
FT                   /inference="protein motif:HMMPfam:IPR011701"
FT                   /inference="protein motif:HMMTigr:IPR004638"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461741.1"
FT                   /protein_id="ABX20105.1"
FT                   /translation="MQQQKPLEGAQLVIMTIALSLATFMQVLDSTIANVAIPTIAGNLG
FT                   SSLSQGTWVITSFGVANAISIPLTGWLAKRFGEVKLFMWSTVAFAAASWACGVSSSLNM
FT                   LIFFRVVQGVVAGPLIPLSQSLLLNNYPPAKRSIALALWSMTVIVAPICGPILGGYISD
FT                   NYHWGWIFFINVPIGVAVVLMTLQTLRGRETRTERRRIDAIGLALLVIGIGSLQIMLDR
FT                   GKELDWFSSQEIIILTVVAVIAISFLIVWELTDDHPIVDLSLFKSRNFTIGCLCISLAY
FT                   MLYFGAIVLLPQLLQEVYGYTATWAGLASAPVGIIPVILSPIIGRFAHKLDMRRLVTFS
FT                   FIMYAVCFYWRAWTFEPGMDFGASAWPQFIQGFAVACFFMPLTTITLSGLPPERLAAAS
FT                   SLSNFTRTLAGSIGTSITTTMWTDRESLHHAQLTESVTAYNPNAQAMYDKLEGLGMTRQ
FT                   QASGWIAQQITNQGLIISANEIFWMSAGIFLVLLGLVWFAKPPFGAGGGGGGAH"
     MQQQKPLEGA QLVIMTIALS LATFMQVLDS TIANVAIPTI AGNLGSSLSQ GTWVITSFGV        60
     ANAISIPLTG WLAKRFGEVK LFMWSTVAFA AASWACGVSS SLNMLIFFRV VQGVVAGPLI       120
     PLSQSLLLNN YPPAKRSIAL ALWSMTVIVA PICGPILGGY ISDNYHWGWI FFINVPIGVA       180
     VVLMTLQTLR GRETRTERRR IDAIGLALLV IGIGSLQIML DRGKELDWFS SQEIIILTVV       240
     AVIAISFLIV WELTDDHPIV DLSLFKSRNF TIGCLCISLA YMLYFGAIVL LPQLLQEVYG       300
     YTATWAGLAS APVGIIPVIL SPIIGRFAHK LDMRRLVTFS FIMYAVCFYW RAWTFEPGMD       360
     FGASAWPQFI QGFAVACFFM PLTTITLSGL PPERLAAASS LSNFTRTLAG SIGTSITTTM       420
     WTDRESLHHA QLTESVTAYN PNAQAMYDKL EGLGMTRQQA SGWIAQQITN QGLIISANEI       480
     FWMSAGIFLV LLGLVWFAKP PFGAGGGGGG AH                                     512
//

If you have problems or comments...

PBIL Back to PBIL home page