(data stored in SCRATCH zone)

EMBL: CP000880.PE153

CP000880.PE153       Location/Qualifiers
FT   CDS             complement(148831..149361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00160"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1846 Transcriptional regulators; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20107"
FT                   /db_xref="GOA:A9MFZ9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9MFZ9"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR000835"
FT                   /inference="protein motif:HMMSmart:IPR000835"
FT                   /inference="protein motif:ScanRegExp:IPR000835"
FT                   /inference="similar to AA sequence:INSD:AAX66653.1"
FT                   /protein_id="ABX20107.1"
FT                   /translation="MDSSFTPIEQMLKFRASRHEDFPYQEILLTRLCMHMQGKLLENRN
FT                   KMLKAQGINETLFMALITLESQENHSIQPSELSCALGSSRTNATRIADELEKRGWIERR
FT                   ESDNDRRCLHLQLTEKGQAFLQEVLPPQHHCLHQLWSSLSTAEKDQLEHITRKLLTRLD
FT                   QMEQEGTVLEALR"
     MDSSFTPIEQ MLKFRASRHE DFPYQEILLT RLCMHMQGKL LENRNKMLKA QGINETLFMA        60
     LITLESQENH SIQPSELSCA LGSSRTNATR IADELEKRGW IERRESDNDR RCLHLQLTEK       120
     GQAFLQEVLP PQHHCLHQLW SSLSTAEKDQ LEHITRKLLT RLDQMEQEGT VLEALR           176
//

If you have problems or comments...

PBIL Back to PBIL home page