(data stored in SCRATCH zone)

EMBL: CP000880.PE167

CP000880.PE167       Location/Qualifiers
FT   CDS             complement(161414..161593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00174"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG35541 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00174"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20121"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG13"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217718.1"
FT                   /protein_id="ABX20121.1"
FT                   /translation="MFTPGDFVQPRIGGPKLKVIEVNEDHIVAVRVDDEQGEKLTLKAA
FT                   DVTPYSEGGDFGLC"
     MFTPGDFVQP RIGGPKLKVI EVNEDHIVAV RVDDEQGEKL TLKAADVTPY SEGGDFGLC         59
//

If you have problems or comments...

PBIL Back to PBIL home page